Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human RNF148 Monoclonal Antibody | anti-RNF148 antibody

RNF148 (Ring Finger Protein 148, MGC35222)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
RNF148; Monoclonal Antibody; RNF148 (Ring Finger Protein 148; MGC35222); Anti -RNF148 (Ring Finger Protein 148; anti-RNF148 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2D3
Specificity
Recognizes human RNF148.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
VFPMSHQGTENIVAVMISNLKGMEILHSIQKGVYVTVIIEVGRMHMQWVSHYIMYLFTFLAATIAYFYLDCVWRLTPRVPNSFTRRRSQIKTDVKKAIDQ*
Applicable Applications for anti-RNF148 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Dilution: Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody.
Immunogen
Partial recombinant protein corresponding to aa139-239 from human RNF148 (NP_932351) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged RNF148 is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RNF148 is 3ng/ml as a capture antibody.)
Related Product Information for anti-RNF148 antibody
RNF148 contains one PA (protease associated) domain and one RING-type zinc finger. The exact function of RNF148 remains unknown.
Product Categories/Family for anti-RNF148 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,067 Da
NCBI Official Full Name
RING finger protein 148
NCBI Official Symbol
RNF148
NCBI Protein Information
RING finger protein 148
UniProt Protein Name
RING finger protein 148
Protein Family
UniProt Gene Name
RNF148
UniProt Entry Name
RN148_BOVIN

Uniprot Description

Subcellular location: Membrane; Single-pass membrane protein

Potential.

Sequence similarities: Contains 1 PA (protease associated) domain.Contains 1 RING-type zinc finger.

Similar Products

Product Notes

The RNF148 rnf148 (Catalog #AAA6011086) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RNF148 (Ring Finger Protein 148, MGC35222) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RNF148 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Dilution: Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody. Researchers should empirically determine the suitability of the RNF148 rnf148 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VFPMSHQGTE NIVAVMISNL KGMEILHSIQ KGVYVTVIIE VGRMHMQWVS HYIMYLFTFL AATIAYFYLD CVWRLTPRVP NSFTRRRSQI KTDVKKAIDQ *. It is sometimes possible for the material contained within the vial of "RNF148, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.