Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human RLIM Monoclonal Antibody | anti-RLIM antibody

RLIM (RING Finger LIM Domain-binding Protein, R-LIM, E3 Ubiquitin-protein Ligase RLIM, LIM Domain-interacting RING Finger Protein, RING Finger Protein 12, RNF12, Renal Carcinoma Antigen NY-REN-43) (MaxLight 750)

Gene Names
RLIM; MRX61; RNF12; TOKAS; NY-REN-43
Reactivity
Human
Applications
Immunofluorescence, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RLIM; Monoclonal Antibody; RLIM (RING Finger LIM Domain-binding Protein; R-LIM; E3 Ubiquitin-protein Ligase RLIM; LIM Domain-interacting RING Finger Protein; RING Finger Protein 12; RNF12; Renal Carcinoma Antigen NY-REN-43) (MaxLight 750); EC=6.3.2.-; MGC15161; anti-RLIM antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G10
Specificity
Recognizes human RNF12.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-RLIM antibody
FLISA, Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IF: 30ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-84 from human RNF12 (NP_057204) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQIKEGPPPQNSDEN
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-RLIM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase RLIM
NCBI Official Synonym Full Names
ring finger protein, LIM domain interacting
NCBI Official Symbol
RLIM
NCBI Official Synonym Symbols
MRX61; RNF12; TOKAS; NY-REN-43
NCBI Protein Information
E3 ubiquitin-protein ligase RLIM
UniProt Protein Name
E3 ubiquitin-protein ligase RLIM
UniProt Gene Name
RLIM
UniProt Synonym Gene Names
RNF12; R-LIM
UniProt Entry Name
RNF12_HUMAN

NCBI Description

The protein encoded by this gene is a RING-H2 zinc finger protein. It has been shown to be an E3 ubiquitin protein ligase that targets LIM domain binding 1 (LDB1/CLIM), and causes proteasome-dependent degradation of LDB1. This protein and LDB1 are co-repressors of LHX1/LIM-1, a homeodomain transcription factor. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Feb 2009]

Uniprot Description

RNF12: E3 ubiquitin-protein ligase. Acts as a negative coregulator for LIM homeodomain transcription factors by mediating the ubiquitination and subsequent degradation of LIM cofactors LDB1 and LDB2 and by mediating the recruitment the SIN3a/histone deacetylase corepressor complex. Ubiquitination and degradation of LIM cofactors LDB1 and LDB2 allows DNA-bound LIM homeodomain transcription factors to interact with other protein partners such as RLIM. Plays a role in telomere length-mediated growth suppression by mediating the ubiquitination and degradation of TERF1. By targeting ZFP42 for degradation, acts as an activator of random inactivation of X chromosome in the embryo, a stochastic process in which one X chromosome is inactivated to minimize sex- related dosage differences of X-encoded genes in somatic cells of female placental mammals. Belongs to the RNF12 family.

Protein type: Ubiquitin ligase; Ubiquitin conjugating system; Ligase; EC 6.3.2.-; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: Xq13-q21

Cellular Component: nucleoplasm; transcriptional repressor complex; cytoplasm; nucleus

Molecular Function: zinc ion binding; ubiquitin-protein ligase activity; transcription corepressor activity; ligase activity

Biological Process: ubiquitin-dependent protein catabolic process; transcription, DNA-dependent; negative regulation of transcription factor activity; protein ubiquitination; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent

Research Articles on RLIM

Similar Products

Product Notes

The RLIM rlim (Catalog #AAA6235017) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RLIM (RING Finger LIM Domain-binding Protein, R-LIM, E3 Ubiquitin-protein Ligase RLIM, LIM Domain-interacting RING Finger Protein, RING Finger Protein 12, RNF12, Renal Carcinoma Antigen NY-REN-43) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RLIM can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB). IF: 30ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RLIM rlim for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RLIM, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.