Mouse anti-Human RLIM Monoclonal Antibody | anti-RLIM antibody

RLIM (RING Finger LIM Domain-binding Protein, R-LIM, E3 Ubiquitin-protein Ligase RLIM, LIM Domain-interacting RING Finger Protein, RING Finger Protein 12, RNF12, Renal Carcinoma Antigen NY-REN-43) APC

Cat. Num. AAA6138756

• Gene Names: RLIM; MRX61; RNF12; TOKAS; NY-REN-43
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RLIM; Monoclonal Antibody; RLIM (RING Finger LIM Domain-binding Protein; R-LIM; E3 Ubiquitin-protein Ligase RLIM; LIM Domain-interacting RING Finger Protein; RING Finger Protein 12; RNF12; Renal Carcinoma Antigen NY-REN-43) APC; EC=6.3.2.-; MGC15161; anti-RLIM antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1G10
• Specificity: Recognizes human RNF12.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-RLIM antibody: ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IF: 30ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-84 from human RNF12 (NP_057204) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQIKEGPPPQNSDEN
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.24kD).)

Western Blot (WB)

(Western Blot analysis of RNF12 expression in transfected 293T cell line by RNF12 monoclonal antibody. Lane 1: RNF12 transfected lysate (68.5kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RNF12 on HeLa cell. [antibody concentration 30ug/ml].)

Immunoprecipitation (IP)

(Immunoprecipitation of RNF12 transfected lysate using RNF12 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with RNF12 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged RNF12 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(RNF12 monoclonal antibody, Western Blot analysis of RNF12 expression in HeLa NE.)

Product Categories/Family for anti-RLIM antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 34452684
• NCBI GeneID: 51132
• NCBI Accession #: NP_057204
• NCBI GenBank Nucleotide #: NM_016120
• UniProt Accession #: Q9NVW2
• Molecular Weight: 68kDa
• NCBI Official Full Name: E3 ubiquitin-protein ligase RLIM
• NCBI Official Synonym Full Names: ring finger protein, LIM domain interacting
• NCBI Official Symbol: RLIM
• NCBI Official Synonym Symbols: MRX61; RNF12; TOKAS; NY-REN-43
• NCBI Protein Information: E3 ubiquitin-protein ligase RLIM
• UniProt Protein Name: E3 ubiquitin-protein ligase RLIM
• Protein Family: E3 ubiquitin-protein ligase
• UniProt Gene Name: RLIM
• UniProt Synonym Gene Names: RNF12; R-LIM
• UniProt Entry Name: RNF12_HUMAN

NCBI Description

The protein encoded by this gene is a RING-H2 zinc finger protein. It has been shown to be an E3 ubiquitin protein ligase that targets LIM domain binding 1 (LDB1/CLIM), and causes proteasome-dependent degradation of LDB1. This protein and LDB1 are co-repressors of LHX1/LIM-1, a homeodomain transcription factor. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Feb 2009]

Uniprot Description

RNF12: E3 ubiquitin-protein ligase. Acts as a negative coregulator for LIM homeodomain transcription factors by mediating the ubiquitination and subsequent degradation of LIM cofactors LDB1 and LDB2 and by mediating the recruitment the SIN3a/histone deacetylase corepressor complex. Ubiquitination and degradation of LIM cofactors LDB1 and LDB2 allows DNA-bound LIM homeodomain transcription factors to interact with other protein partners such as RLIM. Plays a role in telomere length-mediated growth suppression by mediating the ubiquitination and degradation of TERF1. By targeting ZFP42 for degradation, acts as an activator of random inactivation of X chromosome in the embryo, a stochastic process in which one X chromosome is inactivated to minimize sex- related dosage differences of X-encoded genes in somatic cells of female placental mammals. Belongs to the RNF12 family.

Protein type: Ubiquitin ligase; Ubiquitin conjugating system; Ligase; EC 6.3.2.-; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: Xq13-q21

Cellular Component: nucleoplasm; transcriptional repressor complex; cytoplasm; nucleus

Molecular Function: zinc ion binding; ubiquitin-protein ligase activity; transcription corepressor activity; ligase activity

Biological Process: ubiquitin-dependent protein catabolic process; transcription, DNA-dependent; negative regulation of transcription factor activity; protein ubiquitination; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent