Mouse anti-Human RING Finger Protein 40 Monoclonal Antibody | anti-RNF40 antibody

RING Finger Protein 40 (RNF40, 95kD Retinoblastoma Protein Binding Protein, BRE1B, BRE1-B, DKFZp686K191, E3 Ubiquitin Protein Ligase BRE1B, KIAA0661, MGC13051, Rb-associated Protein, RBP95, STARING) (FITC)

Cat. Num. AAA6149340

• Gene Names: RNF40; BRE1B; RBP95; STARING
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RING Finger Protein 40; Monoclonal Antibody; RING Finger Protein 40 (RNF40; 95kD Retinoblastoma Protein Binding Protein; BRE1B; BRE1-B; DKFZp686K191; E3 Ubiquitin Protein Ligase BRE1B; KIAA0661; MGC13051; Rb-associated Protein; RBP95; STARING) (FITC); anti-RNF40 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1C1
• Specificity: Recognizes human RNF40.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 5309

• Applicable Applications for anti-RNF40 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa102-200 (NP_055586) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DETVEALLRCHESQGELSSAPEAPGTQEGPTCDGTPLPEPGTSELRDPLLMQLRPPLSEPALAFVVALGASSSEEVELELQGRMEFSKAAVSRVVEASD
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Testing Data

(Detection limit for recombinant GST tagged RNF40 is ~1ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of RNF40 expression in transfected 293T cell line by RNF40 monoclonal antibody. Lane 1: RNF40 transfected lysate (113.7kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-RNF40 antibody

The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein was reported to interact with the tumor suppressor protein RB1. Studies of the rat counterpart suggested that this protein may function as an E3 ubiquitin-protein ligase, and facilitate the ubiquitination and degradation of syntaxin 1, which is an essential component of the neurotransmitter release machinery.

Product Categories/Family for anti-RNF40 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 1722783670
• NCBI GeneID: 9810
• NCBI Accession #: NM_014771.4
• NCBI GenBank Nucleotide #: NM_014771
• UniProt Accession #: O75150
• NCBI Official Full Name: Homo sapiens ring finger protein 40 (RNF40), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: ring finger protein 40
• NCBI Official Symbol: RNF40
• NCBI Official Synonym Symbols: BRE1B; RBP95; STARING
• NCBI Protein Information: E3 ubiquitin-protein ligase BRE1B
• UniProt Protein Name: E3 ubiquitin-protein ligase BRE1B
• Protein Family: E3 ubiquitin-protein ligase
• UniProt Gene Name: RNF40
• UniProt Synonym Gene Names: BRE1B; KIAA0661; BRE1-B; RBP95
• UniProt Entry Name: BRE1B_HUMAN

NCBI Description

The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein was reported to interact with the tumor suppressor protein RB1. Studies of the rat counterpart suggested that this protein may function as an E3 ubiquitin-protein ligase, and facilitate the ubiquitination and degradation of syntaxin 1, which is an essential component of the neurotransmitter release machinery. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]

Uniprot Description

RNF40: Component of the RNF20/40 E3 ubiquitin-protein ligase complex that mediates monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1). H2BK120ub1 gives a specific tag for epigenetic transcriptional activation and is also prerequisite for histone H3 'Lys-4' and 'Lys-79' methylation (H3K4me and H3K79me, respectively). It thereby plays a central role in histone code and gene regulation. The RNF20/40 complex forms a H2B ubiquitin ligase complex in cooperation with the E2 enzyme UBE2A or UBE2B; reports about the cooperation with UBE2E1/UBCH are contradictory. Required for transcriptional activation of Hox genes. Component of the RNF20/40 complex (also known as BRE1 complex) probably composed of 2 copies of RNF20/BRE1A and 2 copies of RNF40/BRE1B. Interacts with UBE2E1/UBCH6. Interacts with RB1 and WAC. Ubiquitously expressed. Expressed at higher level in testis, heart and pancreas, while it is only weakly expressed in lung, skeletal muscle and small intestine. Belongs to the BRE1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system; Ligase; Ubiquitin ligase; EC 6.3.2.-; EC 6.3.2.19

Chromosomal Location of Human Ortholog: 16p11.2-p11.1

Cellular Component: nucleoplasm; neuron projection; membrane; nucleus; ubiquitin ligase complex

Molecular Function: protein binding; protein homodimerization activity; mRNA 3'-UTR binding; zinc ion binding; ubiquitin protein ligase binding; protein complex binding; syntaxin-1 binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: histone monoubiquitination; ubiquitin-dependent protein catabolic process; regulation of mitotic cell cycle; histone H2B ubiquitination