Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to RNF24 on HeLa cell. [antibody concentration 10ug/ml])
Mouse anti-Human RING Finger Protein 24 Monoclonal Antibody | anti-RNF24 antibody
RING Finger Protein 24 (RNF24, G1L) (AP)
Gene Names
RNF24; G1L
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RING Finger Protein 24; Monoclonal Antibody; RING Finger Protein 24 (RNF24; G1L) (AP); anti-RNF24 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4C6
Specificity
Recognizes human RNF24.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
7620
Applicable Applications for anti-RNF24 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa49-149 from RNF24 (NP_009150) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LRHQAHKEFYAYKQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDRGPPQGPLPGAENIV*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to RNF24 on HeLa cell. [antibody concentration 10ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to RNF24 on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-RNF24 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens ring finger protein 24 (RNF24), transcript variant 1, mRNA
NCBI Official Synonym Full Names
ring finger protein 24
NCBI Official Symbol
RNF24
NCBI Official Synonym Symbols
G1L
NCBI Protein Information
RING finger protein 24
UniProt Protein Name
RING finger protein 24
Protein Family
UniProt Gene Name
RNF24
UniProt Entry Name
RNF24_HUMAN
NCBI Description
This gene encodes an integral membrane protein that contains a RING-type zinc finger. The encoded protein may interact with multiple transient receptor potential cation channel subfamily C (TRPC) proteins and regulate the trafficking and insertion of these proteins into the plasma membrane. [provided by RefSeq, Mar 2016]
Research Articles on RNF24
Similar Products
Product Notes
The RNF24 rnf24 (Catalog #AAA6133479) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RING Finger Protein 24 (RNF24, G1L) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RING Finger Protein 24 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RNF24 rnf24 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RING Finger Protein 24, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
