Western Blot (WB)
(Western Blot detection against Immunogen (34.14kD).)
Mouse anti-Human RING Finger Protein 170 Monoclonal Antibody | anti-RNF170 antibody
RING Finger Protein 170 (RNF170, E3 Ubiquitin-protein Ligase RNF170, Putative LAG1-interacting Protein, SNAX1) (HRP)
Gene Names
RNF170; ADSA; SNAX1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RING Finger Protein 170; Monoclonal Antibody; RING Finger Protein 170 (RNF170; E3 Ubiquitin-protein Ligase RNF170; Putative LAG1-interacting Protein; SNAX1) (HRP); EC=6.3.2.-; anti-RNF170 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2D6
Specificity
Recognizes human RNF170.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-RNF170 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa121-194 from human RNF170 (NP_112216) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LGAISCPICRQTVTLLLTVFGEDDQSQDVLRLHQDINDYNRRFSGQPRSIMERIMDLPTLLRHAFREMFSVGG
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (34.14kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (34.14kD).)
Western Blot (WB)
(RNF170 monoclonal antibody. Western Blot analysis of RNF170 expression in Jurkat.)
Western Blot (WB)
(RNF170 monoclonal antibody. Western Blot analysis of RNF170 expression in Jurkat.)
Product Categories/Family for anti-RNF170 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF170 isoform a
NCBI Official Synonym Full Names
ring finger protein 170
NCBI Official Symbol
RNF170
NCBI Official Synonym Symbols
ADSA; SNAX1
NCBI Protein Information
E3 ubiquitin-protein ligase RNF170
UniProt Protein Name
E3 ubiquitin-protein ligase RNF170
Protein Family
UniProt Gene Name
RNF170
UniProt Entry Name
RN170_HUMAN
NCBI Description
This gene encodes a RING domain-containing protein that resides in the endoplasmic reticulum (ER) membrane. This protein functions as an E3 ubiquitin ligase and mediates ubiquitination and processing of inositol 1,4,5-trisphosphate (IP3) receptors via the ER-associated protein degradation pathway. It is recruited to the activated IP3 receptors by the ERLIN1/ERLIN2 complex to which it is constitutively bound. Mutations in this gene are associated with autosomal dominant sensory ataxia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jun 2012]
Research Articles on RNF170
Similar Products
Product Notes
The RNF170 rnf170 (Catalog #AAA6154682) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RING Finger Protein 170 (RNF170, E3 Ubiquitin-protein Ligase RNF170, Putative LAG1-interacting Protein, SNAX1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RING Finger Protein 170 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RNF170 rnf170 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RING Finger Protein 170, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
