Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human RING Finger Protein 168 Monoclonal Antibody | anti-RNF168 antibody

RING Finger Protein 168 (RNF168, E3 Ubiquitin-protein Ligase RNF168, hRNF168) (Biotin)

Gene Names
RNF168; hRNF168
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RING Finger Protein 168; Monoclonal Antibody; RING Finger Protein 168 (RNF168; E3 Ubiquitin-protein Ligase RNF168; hRNF168) (Biotin); EC=6.3.2.-; anti-RNF168 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3E1
Specificity
Recognizes human RNF168.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-RNF168 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa462-572 from human RNF168 (NP_689830) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVPNRQKGSPDEYHLRATSSPPDKVLNGQRKNPKDGNFKRQTHTKHPTPERGSRDKNRQVSLKMQLKQSVNRRKMPNSTRDHCKVSKSAHSLQPSISQKSVFQMFQRCTK
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(RNF168 monoclonal antibody, Western Blot analysis of RNF168 expression in HepG2.)

Western Blot (WB) (RNF168 monoclonal antibody, Western Blot analysis of RNF168 expression in HepG2.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RNF168 on formalin-fixed paraffin-embedded human prostate cancer. [antibody concentration 1.5ug/ml.)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to RNF168 on formalin-fixed paraffin-embedded human prostate cancer. [antibody concentration 1.5ug/ml.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RNF168 on HepG2 cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RNF168 on HepG2 cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-RNF168 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65,020 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF168
NCBI Official Synonym Full Names
ring finger protein 168, E3 ubiquitin protein ligase
NCBI Official Symbol
RNF168
NCBI Official Synonym Symbols
hRNF168
NCBI Protein Information
E3 ubiquitin-protein ligase RNF168
UniProt Protein Name
E3 ubiquitin-protein ligase RNF168
UniProt Gene Name
RNF168
UniProt Synonym Gene Names
hRNF168
UniProt Entry Name
RN168_HUMAN

NCBI Description

This gene encodes an E3 ubiquitin ligase protein that contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-DNA and protein-protein interactions. The protein is involved in DNA double-strand break (DSB) repair. Mutations in this gene result in Riddle syndrome. [provided by RefSeq, Sep 2011]

Uniprot Description

RNF168: E3 ubiquitin-protein ligase required for accumulation of repair proteins to sites of DNA damage. Acts with UBE2N/UBC13 to amplify the RNF8-dependent histone ubiquitination. Recruited to sites of DNA damage at double-strand breaks (DSBs) by binding to ubiquitinated histone H2A and H2AX and amplifies the RNF8- dependent H2A ubiquitination, promoting the formation of 'Lys-63'- linked ubiquitin conjugates. This leads to concentrate ubiquitinated histones H2A and H2AX at DNA lesions to the threshold required for recruitment of TP53BP1 and BRCA1. Also recruited at DNA interstrand cross-links (ICLs) sites and promotes accumulation of 'Lys-63'-linked ubiquitination of histones H2A and H2AX, leading to recruitment of FAAP20/C1orf86 and Fanconi anemia (FA) complex, followed by interstrand cross-link repair. H2A ubiquitination also mediates the ATM-dependent transcriptional silencing at regions flanking DSBs in cis, a mechanism to avoid collision between transcription and repair intermediates. Also involved in class switch recombination in immune system, via its role in regulation of DSBs repair. Following DNA damage, promotes the ubiquitination and degradation of JMJD2A/KDM4A in collaboration with RNF8, leading to unmask H4K20me2 mark and promote the recruitment of TP53BP1 at DNA damage sites. Not able to initiate 'Lys-63'-linked ubiquitination in vitro; possibly due to partial occlusion of the UBE2N/UBC13-binding region. Catalyzes monoubiquitination of 'Lys-13' and 'Lys-15' of nucleosomal histone H2A (H2AK13Ub and H2AK15Ub, respectively). Defects in RNF168 are the cause of Riddle syndrome (RIDDLES). Riddle syndrome is characterized by increased radiosensitivity, immunodeficiency, mild motor control and learning difficulties, facial dysmorphism, and short stature. Defects are probably due to impaired localization of TP53BP1 and BRCA1 at DNA lesions. Belongs to the RNF168 family.

Protein type: Ubiquitin ligase; EC 6.3.2.-; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 3q29

Cellular Component: nucleoplasm; cytoplasm; nucleus; ubiquitin ligase complex

Molecular Function: ubiquitin binding; protein binding; histone binding; zinc ion binding; nucleosome binding; ubiquitin-protein ligase activity; chromatin binding; ligase activity

Biological Process: ubiquitin-dependent protein catabolic process; positive regulation of DNA repair; double-strand break repair; isotype switching; protein ubiquitination; response to ionizing radiation; response to DNA damage stimulus

Disease: Riddle Syndrome

Research Articles on RNF168

Similar Products

Product Notes

The RNF168 rnf168 (Catalog #AAA6144074) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RING Finger Protein 168 (RNF168, E3 Ubiquitin-protein Ligase RNF168, hRNF168) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RING Finger Protein 168 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RNF168 rnf168 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RING Finger Protein 168, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.