Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human RHOD Monoclonal Antibody | anti-RHOD antibody

RHOD (Rho-related GTP-binding Protein RhoH, GTP-binding Protein TTF, Translocation Three Four Protein, ARHH, TTF) (MaxLight 490)

Gene Names
RHOD; Rho; ARHD; RHOM; RHOHP1
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RHOD; Monoclonal Antibody; RHOD (Rho-related GTP-binding Protein RhoH; GTP-binding Protein TTF; Translocation Three Four Protein; ARHH; TTF) (MaxLight 490); anti-RHOD antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E7
Specificity
Recognizes human RHOD.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-RHOD antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant corresponding to aa1-211 from human RHOD (AAH01338) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHIWDTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLRKDKSLVNKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRGRNFWRRITQGFCVVT
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-RHOD antibody
The protein encoded by this gene is a member of the Ras superfamily of small GTPases. Expression of a chimeric transcript of LAZ3 and this gene has been reported as a result of the translocation t(3;4) in non-Hodgkin's lymphomas. This gene encodes a small G-like protein, and unlike most other small G proteins which are expressed ubiquitously, this gene is transcribed only in hemopoietic cells.
Product Categories/Family for anti-RHOD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
~22 kDa
NCBI Official Full Name
Homo sapiens ras homolog gene family, member D, mRNA
NCBI Official Synonym Full Names
ras homolog family member D
NCBI Official Symbol
RHOD
NCBI Official Synonym Symbols
Rho; ARHD; RHOM; RHOHP1
NCBI Protein Information
rho-related GTP-binding protein RhoD; ras homolog D; Rho-related protein HP1; ras homolog gene family, member A; ras homolog gene family, member D
UniProt Protein Name
Rho-related GTP-binding protein RhoD
Protein Family
UniProt Gene Name
RHOD
UniProt Synonym Gene Names
ARHD; RhoHP1
UniProt Entry Name
RHOD_HUMAN

NCBI Description

Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. The protein encoded by this gene binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. [provided by RefSeq, Jul 2008]

Uniprot Description

RHOD: Involved in endosome dynamics. May coordinate membrane transport with the function of the cytoskeleton. Participates in reorganization of actin cytoskeleton. Belongs to the small GTPase superfamily. Rho family.

Protein type: G protein, monomeric; Motility/polarity/chemotaxis; G protein, monomeric, Rho; G protein

Chromosomal Location of Human Ortholog: 11q14.3

Cellular Component: early endosome; plasma membrane; cytosol

Molecular Function: GTPase activity; GTP binding; protein kinase binding

Biological Process: lamellipodium biogenesis; focal adhesion formation; actin filament bundle formation; regulation of small GTPase mediated signal transduction; positive regulation of cell adhesion; metabolic process; small GTPase mediated signal transduction; regulation of focal adhesion formation; Rho protein signal transduction; protein targeting; positive regulation of cell migration

Research Articles on RHOD

Similar Products

Product Notes

The RHOD rhod (Catalog #AAA6202959) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RHOD (Rho-related GTP-binding Protein RhoH, GTP-binding Protein TTF, Translocation Three Four Protein, ARHH, TTF) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RHOD can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RHOD rhod for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RHOD, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.