Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RHOA monoclonal antibody (M03), clone 1A11 Western Blot analysis of RHOA expression in HeLa (Cat # L013V1).)

Mouse RHOA Monoclonal Antibody | anti-RHOA antibody

RHOA (Ras Homolog Gene Family, Member A, ARH12, ARHA, RHO12, RHOH12) (Biotin)

Gene Names
RHOA; ARHA; ARH12; RHO12; EDFAOB; RHOH12
Applications
Western Blot
Purity
Purified
Synonyms
RHOA; Monoclonal Antibody; RHOA (Ras Homolog Gene Family; Member A; ARH12; ARHA; RHO12; RHOH12) (Biotin); Ras Homolog Gene Family; RHOH12; anti-RHOA antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1, lambda
Clone Number
1A11
Specificity
Recognizes RHOA.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
193
Applicable Applications for anti-RHOA antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RHOA (AAH01360, 1aa-193aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RHOA monoclonal antibody (M03), clone 1A11 Western Blot analysis of RHOA expression in HeLa (Cat # L013V1).)

Western Blot (WB) (RHOA monoclonal antibody (M03), clone 1A11 Western Blot analysis of RHOA expression in HeLa (Cat # L013V1).)

Testing Data

(Detection limit for recombinant GST tagged RHOA is approximately 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RHOA is approximately 3ng/ml as a capture antibody.)
Related Product Information for anti-RHOA antibody
Mouse monoclonal antibody raised against a full length recombinant RHOA.
Product Categories/Family for anti-RHOA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
387
NCBI Official Full Name
Ras homolog gene family, member A
NCBI Official Synonym Full Names
ras homolog family member A
NCBI Official Symbol
RHOA
NCBI Official Synonym Symbols
ARHA; ARH12; RHO12; EDFAOB; RHOH12
NCBI Protein Information
transforming protein RhoA
Protein Family

NCBI Description

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified. [provided by RefSeq, Sep 2015]

Research Articles on RHOA

Similar Products

Product Notes

The RHOA (Catalog #AAA6172478) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RHOA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RHOA for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RHOA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.