Mouse RHOA Monoclonal Antibody | anti-RHOA antibody

RHOA (Ras Homolog Gene Family, Member A, ARH12, ARHA, RHO12, RHOH12) (FITC)

Cat. Num. AAA6176889

• Gene Names: RHOA; ARHA; ARH12; RHO12; EDFAOB; RHOH12
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: RHOA; Monoclonal Antibody; RHOA (Ras Homolog Gene Family; Member A; ARH12; ARHA; RHO12; RHOH12) (FITC); Ras Homolog Gene Family; RHOH12; anti-RHOA antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1, lambda
• Clone Number: 1C3
• Specificity: Recognizes RHOA.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 193

• Applicable Applications for anti-RHOA antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: RHOA (AAH01360, 1aa-193aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RHOA monoclonal antibody (M08), clone 1C3 Western Blot analysis of RHOA expression in A-431 (Cat # L015V1).)

Testing Data

(Detection limit for recombinant GST tagged RHOA is approximately 3ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RHOA on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RHOA on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-RHOA antibody

Mouse monoclonal antibody raised against a full length recombinant RHOA.

Product Categories/Family for anti-RHOA antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 12655025
• NCBI GeneID: 387
• NCBI Official Full Name: Ras homolog gene family, member A
• NCBI Official Synonym Full Names: ras homolog family member A
• NCBI Official Symbol: RHOA
• NCBI Official Synonym Symbols: ARHA; ARH12; RHO12; EDFAOB; RHOH12
• NCBI Protein Information: transforming protein RhoA
• Protein Family: GTP-binding protein

NCBI Description

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified. [provided by RefSeq, Sep 2015]