Mouse anti-Human RGS3 Monoclonal Antibody | anti-RGS3 antibody

RGS3 (Regulator of G-Protein Signaling 3, Regulator of G-Protein Signalling 3, RGS-3, C2PA, FLJ20370, FLJ31516, FLJ90496, PDZ RGS3, PDZ-RGS3, RGP3) (HRP)

Cat. Num. AAA6154622

• Gene Names: RGS3; C2PA; RGP3
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RGS3; Monoclonal Antibody; RGS3 (Regulator of G-Protein Signaling 3; Regulator of G-Protein Signalling 3; RGS-3; C2PA; FLJ20370; FLJ31516; FLJ90496; PDZ RGS3; PDZ-RGS3; RGP3) (HRP); anti-RGS3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1E8-C7
• Specificity: Recognizes human RGS3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-RGS3 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to human RGS3, aa1-193 (AAH18072) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MLRGMYLTRNGNLQRRHTMKEAKDMKNKLGIFRRRSESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RGS3 expression in transfected 293T cell line by RGS3 monoclonal antibody. Lane 1: RGS3 transfected lysate (19.5kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RGS3 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RGS3 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RGS3 is 0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-RGS3 antibody

Antibodies; G Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 17390155
• NCBI GeneID: 5998
• Molecular Weight: 66,478 Da
• NCBI Official Full Name: Homo sapiens regulator of G-protein signaling 3, mRNA
• NCBI Official Synonym Full Names: regulator of G-protein signaling 3
• NCBI Official Symbol: RGS3
• NCBI Official Synonym Symbols: C2PA; RGP3
• NCBI Protein Information: regulator of G-protein signaling 3
• Protein Family: Regulator of G-protein signaling

NCBI Description

This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTPase-activating protein that inhibits G-protein-mediated signal transduction. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding different isoforms. Long isoforms are largely cytosolic and plasma membrane-associated with a function in Wnt signaling and in the epithelial mesenchymal transition, while shorter N-terminally-truncated isoforms can be nuclear. [provided by RefSeq, Jan 2013]