Mouse anti-Human RFC1 Monoclonal Antibody | anti-RFC1 antibody

RFC1 (RFC140, Replication Factor C Subunit 1, Activator 1 140kD Subunit, Activator 1 Large Subunit, Activator 1 Subunit 1, DNA-binding Protein PO-GA, Replication Factor C 140kD Subunit, Replication Factor C Large Subunit, MGC51786) (Biotin)

Cat. Num. AAA6143996

• Gene Names: RFC1; A1; RFC; PO-GA; RECC1; CANVAS; MHCBFB; RFC140
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RFC1; Monoclonal Antibody; RFC1 (RFC140; Replication Factor C Subunit 1; Activator 1 140kD Subunit; Activator 1 Large Subunit; Activator 1 Subunit 1; DNA-binding Protein PO-GA; Replication Factor C 140kD Subunit; Replication Factor C Large Subunit; MGC51786) (Biotin); anti-RFC1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG3,k
• Clone Number: 3F8
• Specificity: Recognizes human RFC1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 4867

• Applicable Applications for anti-RFC1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-110, from human RFC1 (AAH51786) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLPVSSKPGKISRQDPVTYISET
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RFC1 is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-RFC1 antibody

The protein encoded by this gene is the large subunit of replication factor C, which is a five subunit DNA polymerase accessory protein. Replication factor C is a DNA-dependent ATPase that is required for eukaryotic DNA replication and repair. The protein acts as an activator of DNA polymerases, binds to the 3' end of primers, and promotes coordinated synthesis of both strands. It also may have a role in telomere stability. [provided by RefSeq].

Product Categories/Family for anti-RFC1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 1249621739
• NCBI GeneID: 5981
• NCBI Official Full Name: Homo sapiens replication factor C (activator 1) 1, 145kDa, mRNA
• NCBI Official Synonym Full Names: replication factor C subunit 1
• NCBI Official Symbol: RFC1
• NCBI Official Synonym Symbols: A1; RFC; PO-GA; RECC1; CANVAS; MHCBFB; RFC140
• NCBI Protein Information: replication factor C subunit 1
• Protein Family: Replication factor

NCBI Description

This gene encodes the large subunit of replication factor C, a five subunit DNA polymerase accessory protein, which is a DNA-dependent ATPase required for eukaryotic DNA replication and repair. The large subunit acts as an activator of DNA polymerases, binds to the 3' end of primers, and promotes coordinated synthesis of both strands. It may also have a role in telomere stability. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Mar 2011]