Western Blot (WB)
(Western Blot detection against Immunogen (34.03kD).)
Mouse anti-Human REEP5 Monoclonal Antibody | anti-REEP5 antibody
REEP5 (C5orf18, DP1, TB2, Receptor Expression-enhancing Protein 5, Polyposis Locus Protein 1, Protein TB2, MGC70440) (AP)
Gene Names
REEP5; DP1; TB2; YOP1; POB16; Yip2e; D5S346; C5orf18
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
REEP5; Monoclonal Antibody; REEP5 (C5orf18; DP1; TB2; Receptor Expression-enhancing Protein 5; Polyposis Locus Protein 1; Protein TB2; MGC70440) (AP); anti-REEP5 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G11
Specificity
Recognizes human C5orf18.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
189
Applicable Applications for anti-REEP5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa113-185 from C5orf18 (NP_005660) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKS*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (34.03kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (34.03kD).)
Related Product Information for anti-REEP5 antibody
REEP5 may promote functional cell surface expression of olfactory receptors.
Product Categories/Family for anti-REEP5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
receptor expression-enhancing protein 5
NCBI Official Synonym Full Names
receptor accessory protein 5
NCBI Official Symbol
REEP5
NCBI Official Synonym Symbols
DP1; TB2; YOP1; POB16; Yip2e; D5S346; C5orf18
NCBI Protein Information
receptor expression-enhancing protein 5
UniProt Protein Name
Receptor expression-enhancing protein 5
Protein Family
UniProt Gene Name
REEP5
UniProt Synonym Gene Names
C5orf18; DP1; TB2
UniProt Entry Name
REEP5_HUMAN
Uniprot Description
REEP5: May promote functional cell surface expression of olfactory receptors. Belongs to the DP1 family.
Protein type: Membrane protein, multi-pass; Membrane protein, integral
Chromosomal Location of Human Ortholog: 5q22-q23
Cellular Component: integral to membrane
Molecular Function: protein binding
Research Articles on REEP5
Similar Products
Product Notes
The REEP5 reep5 (Catalog #AAA6133380) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The REEP5 (C5orf18, DP1, TB2, Receptor Expression-enhancing Protein 5, Polyposis Locus Protein 1, Protein TB2, MGC70440) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's REEP5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the REEP5 reep5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "REEP5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
