Testing Data
(Detection limit for recombinant GST tagged RECQL is 3ng/ml as a capture antibody.)
Mouse anti-Human RECQL Monoclonal Antibody | anti-RECQL antibody
RECQL (ATP-dependent DNA Helicase Q1, DNA Helicase, RecQ-like Type 1, RecQ1, DNA-dependent ATPase Q1, RecQ Protein-like 1, RECQ1, RECQL1) APC
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RECQL; Monoclonal Antibody; RECQL (ATP-dependent DNA Helicase Q1; DNA Helicase; RecQ-like Type 1; RecQ1; DNA-dependent ATPase Q1; RecQ Protein-like 1; RECQ1; RECQL1) APC; anti-RECQL antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4D5
Specificity
Recognizes human RECQL.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
649
Applicable Applications for anti-RECQL antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa549-649, from human RECQL (NP_116559) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FLIQQYLKEDYSFTAYATISYLKIGPKANLLNNEAHAITMQVTKSTQNSFRAESSQTCHSEQGDKKMEEKNSGNFQKKAANMLQQSGSKNTGAKKRKIDD
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged RECQL is 3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged RECQL is 3ng/ml as a capture antibody.)
Related Product Information for anti-RECQL antibody
DNA helicase that may play a role in the repair of DNA that is damaged by ultraviolet light or other mutagens. Exhibits a magnesium-dependent ATP-dependent DNA-helicase activity that unwinds single- and double-stranded DNA in a 3'-5' direction.
Product Categories/Family for anti-RECQL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ATP-dependent DNA helicase Q1
UniProt Protein Name
ATP-dependent DNA helicase Q1
Protein Family
UniProt Gene Name
RECQL
UniProt Synonym Gene Names
RECQ1; RECQL1; RecQ1
UniProt Entry Name
RECQ1_HUMAN
Similar Products
Product Notes
The RECQL recql (Catalog #AAA6138681) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RECQL (ATP-dependent DNA Helicase Q1, DNA Helicase, RecQ-like Type 1, RecQ1, DNA-dependent ATPase Q1, RecQ Protein-like 1, RECQ1, RECQL1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RECQL can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RECQL recql for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RECQL, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
