Mouse anti-Human RBMS3 Monoclonal Antibody | anti-RBMS3 antibody

RBMS3 (RNA-binding Motif, Single-stranded-interacting Protein 3) (PE)

Cat. Num. AAA6159876

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RBMS3; Monoclonal Antibody; RBMS3 (RNA-binding Motif; Single-stranded-interacting Protein 3) (PE); anti-RBMS3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B11
• Specificity: Recognizes human RBMS3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 420

• Applicable Applications for anti-RBMS3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa311-421 from human RBMS3 (NP_055298) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QPTGAVITPTMDHPMSMQPANMMGPLTQQMNHLSLGTTGTYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK*
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Related Product Information for anti-RBMS3 antibody

RBMS3 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis.The protein encoded by this gene is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. The encoded protein was isolated by virtue of its binding to an upstream element of the alpha2(I) collagen promoter. The observation that this protein localizes mostly in the cytoplasm suggests that it may be involved in a cytoplasmic function such as controlling RNA metabolism, rather than transcription. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Product Categories/Family for anti-RBMS3 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 51317351
• NCBI Accession #: NP_055298
• NCBI GenBank Nucleotide #: NM_014483
• UniProt Accession #: Q6XE24
• NCBI Official Full Name: RNA-binding motif, single-stranded-interacting protein 3 isoform 2
• UniProt Protein Name: RNA-binding motif, single-stranded-interacting protein 3
• Protein Family: RNA-binding motif, single-stranded-interacting protein
• UniProt Gene Name: RBMS3
• UniProt Entry Name: RBMS3_HUMAN

Uniprot Description

RBMS3: Binds poly(A) and poly(U) oligoribonucleotides. 4 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 3p24-p23

Cellular Component: cytoplasm

Molecular Function: mRNA 3'-UTR binding; nucleotide binding

Biological Process: positive regulation of translation