Mouse anti-Human RBMS2 Monoclonal Antibody | anti-RBMS2 antibody

RBMS2 (SCR3, RNA-binding Motif, Single-stranded-interacting Protein 2, Suppressor of CDC2 with RNA-binding Motif 3, FLJ39093, FLJ40023, FLJ43262) (PE)

Cat. Num. AAA6159875

• Gene Names: RBMS2; SCR3
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RBMS2; Monoclonal Antibody; RBMS2 (SCR3; RNA-binding Motif; Single-stranded-interacting Protein 2; Suppressor of CDC2 with RNA-binding Motif 3; FLJ39093; FLJ40023; FLJ43262) (PE); anti-RBMS2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4E2
• Specificity: Recognizes human RBMS2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-RBMS2 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa308-407, from human RBMS2 (NP_002889) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: HHHSYLMQPSGSVLTPGMDHPISLQPASMMGPLTQQLGHLSLSSTGTYMPTAAAMQGAYISQYTPVPSSSVSVEESSGQQNQVAVDAPSEHGVYSFQFN
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RBMS2 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RBMS2 is ~1ng/ml as a capture antibody.)

Product Categories/Family for anti-RBMS2 antibody

Antibodies; RNA Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4506449
• NCBI GeneID: 5939
• NCBI Accession #: NP_002889
• NCBI GenBank Nucleotide #: NM_002898
• UniProt Accession #: Q15434
• Molecular Weight: 44kDa
• NCBI Official Full Name: RNA-binding motif, single-stranded-interacting protein 2
• NCBI Official Synonym Full Names: RNA binding motif single stranded interacting protein 2
• NCBI Official Symbol: RBMS2
• NCBI Official Synonym Symbols: SCR3
• NCBI Protein Information: RNA-binding motif, single-stranded-interacting protein 2
• UniProt Protein Name: RNA-binding motif, single-stranded-interacting protein 2
• Protein Family: RNA-binding motif, single-stranded-interacting protein
• UniProt Gene Name: RBMS2
• UniProt Synonym Gene Names: SCR3
• UniProt Entry Name: RBMS2_HUMAN

NCBI Description

The protein encoded by this gene is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. The RBMS proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. This protein was isolated by phenotypic complementation of cdc2 and cdc13 mutants of yeast and is thought to suppress cdc2 and cdc13 mutants through the induction of translation of cdc2. [provided by RefSeq, Jul 2008]

Uniprot Description

RBMS2:

Protein type: RNA-binding

Chromosomal Location of Human Ortholog: 12q13.3

Cellular Component: nucleus

Molecular Function: RNA binding; nucleotide binding

Biological Process: RNA processing