Mouse anti-Human, Mouse RBM9 Monoclonal Antibody | anti-RBFOX2 antibody

RBM9 (RNA Binding Motif Protein 9, RNA Binding Protein 9, Hexaribonucleotide Binding Protein 2, HRNBP2, Repressor of Tamoxifen Transcriptional Activity, RTA)

Cat. Num. AAA643912

• Reactivity: Human, Mouse
• Applications: ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: RBM9; Monoclonal Antibody; RBM9 (RNA Binding Motif Protein 9; RNA Binding Protein 9; Hexaribonucleotide Binding Protein 2; HRNBP2; Repressor of Tamoxifen Transcriptional Activity; RTA); Anti -RBM9 (RNA Binding Motif Protein 9; anti-RBFOX2 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G3
• Specificity: Recognizes human RBM9. Species Crossreactivity: mouse.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQS

• Applicable Applications for anti-RBFOX2 antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.; Dilution: Immunofluorescence: 10ug/ml; Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Partial recombinant corresponding to aa1-100 from RBM9 (AAH13115) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RBM9 expression in transfected 293T cell line by RBM9 monoclonal antibody|Lane 1: RBM9 transfected lysate (40.4kD).|Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RBM9 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RBM9 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RBM9 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of RBM9 over-expressed 293 cell line, cotransfected with RBM9 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RBM9 monoclonal antibody.|GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB)

(RBM9 monoclonal antibody Western Blot analysis of RBM9 expression in NIH/3T3.)

Western Blot (WB)

(Western Blot detection against Immunogen (37kD) .)

Related Product Information for anti-RBFOX2 antibody

This gene is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Product Categories/Family for anti-RBFOX2 antibody

Antibodies; Abs to RNA Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 47678649
• UniProt Accession #: O43251; Q0PRL5; Q0VH35; Q5TF71; Q6IC09; Q8TD00; Q8WYB1; Q96DZ6; A4F5G8; A8K5Z5; B0QYY8; B0QYY9
• Molecular Weight: 41,374 Da
• NCBI Official Full Name: RBM9
• UniProt Protein Name: RNA binding protein fox-1 homolog 2
• Protein Family: RNA binding protein
• UniProt Gene Name: RBFOX2
• UniProt Synonym Gene Names: FOX2; HRNBP2; RBM9; RTA
• UniProt Entry Name: RFOX2_HUMAN

Uniprot Description

RBM9: RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements. Prevents binding of U2AF2 to the 3'-splice site. Regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis. RNA-binding protein that seems to act as a coregulatory factor of ER-alpha. 10 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding; Nuclear receptor co-regulator; Transcription, coactivator/corepressor; RNA splicing

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: mRNA binding; protein binding; RNA binding; nucleotide binding; transcription factor binding; transcription corepressor activity

Biological Process: estrogen receptor signaling pathway; RNA metabolic process; RNA splicing; dendrite morphogenesis; radial glia guided migration of Purkinje cell; neuromuscular process controlling balance; mRNA processing; negative regulation of transcription, DNA-dependent; regulation of alternative nuclear mRNA splicing, via spliceosome; regulation of cell proliferation