Mouse anti-Human, Mouse RBM9 Monoclonal Antibody | anti-RBM9 antibody

RBM9 (RNA Binding Motif Protein 9, RNA Binding Protein 9, Hexaribonucleotide Binding Protein 2, HRNBP2, Repressor of Tamoxifen Transcriptional Activity, RTA) (FITC)

Cat. Num. AAA6149267

• Gene Names: RBFOX2; RTA; fxh; FOX2; RBM9; Fox-2; HNRBP2; HRNBP2; dJ106I20.3
• Reactivity: Human, Mouse
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RBM9; Monoclonal Antibody; RBM9 (RNA Binding Motif Protein 9; RNA Binding Protein 9; Hexaribonucleotide Binding Protein 2; HRNBP2; Repressor of Tamoxifen Transcriptional Activity; RTA) (FITC); anti-RBM9 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4G3
• Specificity: Recognizes human RBM9. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-RBM9 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-100 from RBM9 (AAH13115) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQS
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RBM9 expression in transfected 293T cell line by RBM9 monoclonal antibody Lane 1: RBM9 transfected lysate (40.4kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RBM9 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RBM9 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RBM9 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of RBM9 over-expressed 293 cell line, cotransfected with RBM9 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RBM9 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB)

(RBM9 monoclonal antibody Western Blot analysis of RBM9 expression in NIH/3T3.)

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Product Categories/Family for anti-RBM9 antibody

Antibodies; RNA Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 15341870
• NCBI GeneID: 23543
• Molecular Weight: 41KD
• NCBI Official Full Name: Homo sapiens RNA binding motif protein 9, mRNA
• NCBI Official Synonym Full Names: RNA binding fox-1 homolog 2
• NCBI Official Symbol: RBFOX2
• NCBI Official Synonym Symbols: RTA; fxh; FOX2; RBM9; Fox-2; HNRBP2; HRNBP2; dJ106I20.3
• NCBI Protein Information: RNA binding protein fox-1 homolog 2

NCBI Description

This gene is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]