Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human RBM6 Monoclonal Antibody | anti-RBM6 antibody

RBM6 (RNA-binding Protein 6, Lung Cancer Antigen NY-LU-12, Protein G16, RNA-binding Motif Protein 6, RNA-binding Protein DEF-3, DEF3) (AP)

Gene Names
RBM6; 3G2; g16; DEF3; DEF-3; HLC-11; NY-LU-12
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RBM6; Monoclonal Antibody; RBM6 (RNA-binding Protein 6; Lung Cancer Antigen NY-LU-12; Protein G16; RNA-binding Motif Protein 6; RNA-binding Protein DEF-3; DEF3) (AP); anti-RBM6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E9
Specificity
Recognizes human RBM6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
3630
Applicable Applications for anti-RBM6 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1024-1123 from RBM6 (NP_005768) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLASSEEAEGRMRGPSVGASGRTSKRQSNETYRDAVRRVMFARYKELD
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RBM6 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to RBM6 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RBM6 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RBM6 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-RBM6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens RNA binding motif protein 6 (RBM6), transcript variant 1, mRNA
NCBI Official Synonym Full Names
RNA binding motif protein 6
NCBI Official Symbol
RBM6
NCBI Official Synonym Symbols
3G2; g16; DEF3; DEF-3; HLC-11; NY-LU-12
NCBI Protein Information
RNA-binding protein 6
UniProt Protein Name
RNA-binding protein 6
Protein Family
UniProt Gene Name
RBM6
UniProt Synonym Gene Names
DEF3
UniProt Entry Name
RBM6_HUMAN

Uniprot Description

RBM6: an RNA binding protein that specifically binds poly(G) RNA homopolymers in vitro. It is expressed in hematopoietic progenitors and macrophages, is high in the thymus, lymph nodes, and PBL, and is down-regulated in granulocytes. Has high sequence homology with RBM5 and RBM10 proteins. RBM6 and RBM5, a potential tumor suppressor, are co-deleted in some lung cancers.

Protein type: RNA-binding

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: nucleus

Molecular Function: DNA binding; RNA binding; nucleotide binding

Biological Process: RNA processing

Research Articles on RBM6

Similar Products

Product Notes

The RBM6 rbm6 (Catalog #AAA6133356) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RBM6 (RNA-binding Protein 6, Lung Cancer Antigen NY-LU-12, Protein G16, RNA-binding Motif Protein 6, RNA-binding Protein DEF-3, DEF3) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RBM6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RBM6 rbm6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RBM6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.