Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Mouse anti-Human RBM5 Monoclonal Antibody | anti-RBM5 antibody

RBM5 (RNA-binding Protein 5, RNA-binding Motif Protein 5, Putative Tumor Suppressor LUCA15, Protein G15, Renal Carcinoma Antigen NY-REN-9, H37, LUCA15) APC

Gene Names
RBM5; G15; H37; RMB5; LUCA15
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RBM5; Monoclonal Antibody; RBM5 (RNA-binding Protein 5; RNA-binding Motif Protein 5; Putative Tumor Suppressor LUCA15; Protein G15; Renal Carcinoma Antigen NY-REN-9; H37; LUCA15) APC; anti-RBM5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B6
Specificity
Recognizes human RBM5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-RBM5 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa75-184 RBM5 (AAH02957) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GYHSDGDYGEHDYRHDISDERESKTIMLRGLPITITESDIREMMESFEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRPKFED
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB)

(Western Blot analysis of RBM5 expression in transfected 293T cell line by RBM5 monoclonal antibody Lane 1: RBM5 transfected lysate (61.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RBM5 expression in transfected 293T cell line by RBM5 monoclonal antibody Lane 1: RBM5 transfected lysate (61.5kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RBM5 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to RBM5 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RBM5 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RBM5 on HeLa cell. [antibody concentration 10ug/ml])

Western Blot (WB)

(Western blot analysis of RBM5 over-expressed 293 cell line, cotransfected with RBM5 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RBM5 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of RBM5 over-expressed 293 cell line, cotransfected with RBM5 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RBM5 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-RBM5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
17,891 Da
NCBI Official Full Name
Homo sapiens RNA binding motif protein 5, mRNA
NCBI Official Synonym Full Names
RNA binding motif protein 5
NCBI Official Symbol
RBM5
NCBI Official Synonym Symbols
G15; H37; RMB5; LUCA15
NCBI Protein Information
RNA-binding protein 5
Protein Family

NCBI Description

This gene is a candidate tumor suppressor gene which encodes a nuclear RNA binding protein that is a component of the spliceosome A complex. The encoded protein plays a role in the induction of cell cycle arrest and apoptosis through pre-mRNA splicing of multiple target genes including the tumor suppressor protein p53. This gene is located within the tumor suppressor region 3p21.3, and may play a role in the inhibition of tumor transformation and progression of several malignancies including lung cancer. [provided by RefSeq, Oct 2011]

Research Articles on RBM5

Similar Products

Product Notes

The RBM5 (Catalog #AAA6138658) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RBM5 (RNA-binding Protein 5, RNA-binding Motif Protein 5, Putative Tumor Suppressor LUCA15, Protein G15, Renal Carcinoma Antigen NY-REN-9, H37, LUCA15) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RBM5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RBM5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RBM5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.