SDS-Page
Double-stranded RNA-binding protein 5 Recombinant Protein | DRB5 recombinant protein
Recombinant Arabidopsis thaliana Double-stranded RNA-binding protein 5
Gene Names
DRB5; dsRNA-binding protein 5; MEE6.14; MEE6_14
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Double-stranded RNA-binding protein 5; Recombinant Arabidopsis thaliana Double-stranded RNA-binding protein 5; dsRNA-binding protein 5; AtDRB5; DRB5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-393
Sequence
MYKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKASVNFNGEIFESPTYCSTLRQAEHAAAEVSLNVLSSRVPSKSLTAKILDETGIYKNLLQETAHRAGLDLPMYTSVRSGSCHFPGFSCTVELAGMTFTGESAKTKKQAEKNAAIAAWSSLKKMSSLDSQDEEKEQEAVARVLSRFKPKEVRRRETTNQWRRRTSQQDSNKDLLIERLRWINLLTNQASSSSSTSTPNQHKNSSFISLIPPPPPPKSSKILPFIQQYKDRSSQEAKTETATEMINSKAKVNETSTRLSKQMPFSDMNRYNFVGGCSVNPYSLAPAVQMRSVIPVFAAPPPKPNPNLNPSSLSSSVNEFTSSNNSCSVLNTPGLGGQEKKNLTREMIKLGSESRILDQTHDS
Sequence Length
393
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-Page
SDS-Page
Related Product Information for DRB5 recombinant protein
Binds double-stranded RNA. May be involved in RNA-mediated silencing.
Product Categories/Family for DRB5 recombinant protein
References
"Structural analysis of Arabidopsis thaliana chromosome 5. IV. Sequence features of the regions of 1,456,315 bp covered by nineteen physically assigned P1 and TAC clones."
Sato S., Kaneko T., Kotani H., Nakamura Y., Asamizu E., Miyajima N., Tabata S.
DNA Res. 5:41-54(1998)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
45.64KD
NCBI Official Full Name
dsRNA-binding protein 5
NCBI Official Symbol
DRB5
NCBI Official Synonym Symbols
dsRNA-binding protein 5; MEE6.14; MEE6_14
NCBI Protein Information
dsRNA-binding protein 5
UniProt Protein Name
Double-stranded RNA-binding protein 5
Protein Family
UniProt Gene Name
DRB5
UniProt Synonym Gene Names
AtDRB5
UniProt Entry Name
DRB5_ARATH
Uniprot Description
Binds double-stranded RNA. May be involved in RNA-mediated silencing.
Research Articles on DRB5
Similar Products
Product Notes
The DRB5 drb5 (Catalog #AAA969734) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-393. The amino acid sequence is listed below: MYKNQLQELA QRSCFNLPSY TCIREGPDHA PRFKASVNFN GEIFESPTYC STLRQAEHAA AEVSLNVLSS RVPSKSLTAK ILDETGIYKN LLQETAHRAG LDLPMYTSVR SGSCHFPGFS CTVELAGMTF TGESAKTKKQ AEKNAAIAAW SSLKKMSSLD SQDEEKEQEA VARVLSRFKP KEVRRRETTN QWRRRTSQQD SNKDLLIERL RWINLLTNQA SSSSSTSTPN QHKNSSFISL IPPPPPPKSS KILPFIQQYK DRSSQEAKTE TATEMINSKA KVNETSTRLS KQMPFSDMNR YNFVGGCSVN PYSLAPAVQM RSVIPVFAAP PPKPNPNLNP SSLSSSVNEF TSSNNSCSVL NTPGLGGQEK KNLTREMIKL GSESRILDQT HDS. It is sometimes possible for the material contained within the vial of "Double-stranded RNA-binding protein 5, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
