Mouse anti-Human RBAK Monoclonal Antibody | anti-RBAK antibody

RBAK (RB-associated KRAB Zinc Finger Protein, RB-associated KRAB Repressor, hRBaK, Zinc Finger Protein 769, ZNF769) (PE)

Cat. Num. AAA6159856

• Gene Names: RBAK; ZNF769
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RBAK; Monoclonal Antibody; RBAK (RB-associated KRAB Zinc Finger Protein; RB-associated KRAB Repressor; hRBaK; Zinc Finger Protein 769; ZNF769) (PE); anti-RBAK antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6F9
• Specificity: Recognizes human RBAK.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-RBAK antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa51-151 from human RBAK (NP_066986) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TTKPNVIIKLEQGEEPWIMGGEFPCQHSPEAWRVDDLIERIQENEDKHSRQAACINSKTLTEEKENTFSQIYMETSLVPSSIIAHNCVSCGKNLESISQL
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged RBAK is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-RBAK antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 13430850
• NCBI GeneID: 57786
• NCBI Accession #: NP_066986
• NCBI GenBank Nucleotide #: NM_021163
• UniProt Accession #: Q9NYW8
• Molecular Weight: 83kDa
• NCBI Official Full Name: RB-associated KRAB zinc finger protein
• NCBI Official Synonym Full Names: RB associated KRAB zinc finger
• NCBI Official Symbol: RBAK
• NCBI Official Synonym Symbols: ZNF769
• NCBI Protein Information: RB-associated KRAB zinc finger protein
• UniProt Protein Name: RB-associated KRAB zinc finger protein
• Protein Family: RB-associated KRAB zinc finger protein
• UniProt Gene Name: RBAK
• UniProt Synonym Gene Names: ZNF769; hRBaK
• UniProt Entry Name: RBAK_HUMAN

NCBI Description

This gene encodes a nuclear protein which interacts with the tumor suppressor retinoblastoma 1. The two interacting proteins are thought to act as a transcriptional repressor for promoters which are activated by the E2F1 transcription factor. This protein contains a Kruppel-associated box (KRAB), which is a transcriptional repressor motif. Read-through transcripts that include exons from the downstream gene LOC389458 are expressed from this locus. [provided by RefSeq, Mar 2011]

Uniprot Description

RBAK: May repress E2F-dependent transcription. May promote AR- dependent transcription. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 7p22.1

Cellular Component: nucleus

Molecular Function: nucleic acid binding; zinc ion binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; negative regulation of transcription, DNA-dependent