Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Mouse RASSF8 Monoclonal Antibody | anti-RASSF8 antibody

RASSF8 (Ras Association Domain-containing Protein 8, Carcinoma-associated Protein HOJ-1, C12orf2) (AP)

Gene Names
RASSF8; HOJ1; C12orf2
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RASSF8; Monoclonal Antibody; RASSF8 (Ras Association Domain-containing Protein 8; Carcinoma-associated Protein HOJ-1; C12orf2) (AP); anti-RASSF8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G1
Specificity
Recognizes human RASSF8. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-RASSF8 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa40-138 from RASSF8 (NP_009142) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YTLIEKWRDTERHLAPHENPIISLNKWGQYASDVQLILRRTGPSLSERPTSDSVARIPERTLYRQSLPPLAKLRPQIDKSIKRREPKRKSLTFTGGAK
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB)

(RASSF8 monoclonal antibody Western Blot analysis of RASSF8 expression in NIH/3T3)

Western Blot (WB) (RASSF8 monoclonal antibody Western Blot analysis of RASSF8 expression in NIH/3T3)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RASSF8 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to RASSF8 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RASSF8 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RASSF8 on HeLa cell. [antibody concentration 10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of RASSF8 transfected lysate using RASSF8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RASSF8 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of RASSF8 transfected lysate using RASSF8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RASSF8 rabbit polyclonal antibody.)

Western Blot (WB)

(RASSF8 monoclonal antibody Western Blot analysis of RASSF8 expression in PC-12)

Western Blot (WB) (RASSF8 monoclonal antibody Western Blot analysis of RASSF8 expression in PC-12)

Western Blot (WB)

(RASSF8 monoclonal antibody Western Blot analysis of RASSF8 expression in HeLa.)

Western Blot (WB) (RASSF8 monoclonal antibody Western Blot analysis of RASSF8 expression in HeLa.)
Product Categories/Family for anti-RASSF8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
ras association domain-containing protein 8 isoform a
NCBI Official Synonym Full Names
Ras association domain family member 8
NCBI Official Symbol
RASSF8
NCBI Official Synonym Symbols
HOJ1; C12orf2
NCBI Protein Information
ras association domain-containing protein 8
UniProt Protein Name
Ras association domain-containing protein 8
UniProt Gene Name
RASSF8
UniProt Synonym Gene Names
C12orf2
UniProt Entry Name
RASF8_HUMAN

NCBI Description

This gene encodes a member of the Ras-assocation domain family (RASSF) of tumor suppressor proteins. This gene is essential for maintaining adherens junction function in epithelial cells and has a role in epithelial cell migration. It is a lung tumor suppressor gene candidate. A chromosomal translocation t(12;22)(p11.2;q13.3) leading to the fusion of this gene and the FBLN1 gene is found in a complex type of synpolydactyly. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]

Research Articles on RASSF8

Similar Products

Product Notes

The RASSF8 rassf8 (Catalog #AAA6133338) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RASSF8 (Ras Association Domain-containing Protein 8, Carcinoma-associated Protein HOJ-1, C12orf2) (AP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RASSF8 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RASSF8 rassf8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RASSF8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.