Testing Data
(Immunoperoxidase of monoclonal antibody to RASGRP4 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml])
Mouse RASGRP4 Monoclonal Antibody | anti-RASGRP4 antibody
RASGRP4 (RAS Guanyl Releasing Protein 4) (FITC)
Applications
Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
RASGRP4; Monoclonal Antibody; RASGRP4 (RAS Guanyl Releasing Protein 4) (FITC); RAS Guanyl Releasing Protein 4; anti-RASGRP4 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6D3
Specificity
Recognizes RASGRP4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-RASGRP4 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RASGRP4 (NP_733748, 574aa-673aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CGLCCHKHCRDQVKVECKKRPGAKGDAGPPGAPVPSTPAPHASCGSEENHSYTLSLEPETGCQLRHAWTQTESPHPSWETDTVPCPVMDPPSTASSKLDS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Immunoperoxidase of monoclonal antibody to RASGRP4 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml])
Testing Data
(Immunoperoxidase of monoclonal antibody to RASGRP4 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml])
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to RASGRP4 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml])
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to RASGRP4 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml])
Testing Data
(Detection limit for recombinant GST tagged RASGRP4 is approximately 0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged RASGRP4 is approximately 0.03ng/ml as a capture antibody.)
Related Product Information for anti-RASGRP4 antibody
The protein encoded by this gene is a member of the Ras guanyl nucleotide-releasing protein (RasGRP) family of Ras guanine nucleotide exchange factors. It contains a Ras exchange motif, a diacylglycerol-binding domain, and two calcium-binding EF hands. This protein was shown to activate H-Ras in a cation-dependent manner in vitro. Expression of this protein in myeloid cell lines was found to be correlated with elevated level of activated RAS protein, and the RAS activation can be greatly enhanced by phorbol ester treatment, which suggested a role of this protein in diacylglycerol regulated cell signaling pathways. Studies of a mast cell leukemia cell line expressing substantial amounts of abnormal transcripts of this gene indicated that this gene may play an important role in the final stages of mast cell development. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-RASGRP4 antibody
NCBI and Uniprot Product Information
NCBI GI #
Protein Family
Similar Products
Product Notes
The RASGRP4 (Catalog #AAA6175173) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RASGRP4 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RASGRP4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RASGRP4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
