Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human RASGRP4 Monoclonal Antibody | anti-RASGRP4 antibody

RASGRP4 (RAS Guanyl-releasing Protein 4)

Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
RASGRP4; Monoclonal Antibody; RASGRP4 (RAS Guanyl-releasing Protein 4); Anti -RASGRP4 (RAS Guanyl-releasing Protein 4); anti-RASGRP4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F3
Specificity
Recognizes human RASGRP4.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
CGLCCHKHCRDQVKVECKKRPGAKGDAGPPGAPVPSTPAPHASCGSEENHSYTLSLEPETGCQLRHAWTQTESPHPSWETDTVPCPVMDPPSTASSKLDS
Applicable Applications for anti-RASGRP4 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa574-674 from human RASGRP4 (NP_733748) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RASGRP4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to RASGRP4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged RASGRP4 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RASGRP4 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-RASGRP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
74,882 Da
NCBI Official Full Name
RAS guanyl-releasing protein 4 isoform g
NCBI Official Synonym Full Names
RAS guanyl releasing protein 4
NCBI Official Symbol
RASGRP4
NCBI Protein Information
RAS guanyl-releasing protein 4; guanyl nucleotide releasing protein 4
UniProt Protein Name
RAS guanyl-releasing protein 4
UniProt Gene Name
RASGRP4
UniProt Entry Name
GRP4_HUMAN

NCBI Description

The protein encoded by this gene is a member of the Ras guanyl nucleotide-releasing protein (RasGRP) family of Ras guanine nucleotide exchange factors. It contains a Ras exchange motif, a diacylglycerol-binding domain, and two calcium-binding EF hands. This protein was shown to activate H-Ras in a cation-dependent manner in vitro. Expression of this protein in myeloid cell lines was found to be correlated with elevated level of activated RAS protein, and the RAS activation can be greatly enhanced by phorbol ester treatment, which suggested a role of this protein in diacylglycerol regulated cell signaling pathways. Studies of a mast cell leukemia cell line expressing substantial amounts of abnormal transcripts of this gene indicated that this gene may play an important role in the final stages of mast cell development. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2009]

Uniprot Description

RASGRP4: Functions as a cation- and diacylglycerol (DAG)- regulated nucleotide exchange factor activating Ras through the exchange of bound GDP for GTP. May function in mast cells differentiation. Belongs to the RASGRP family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: GAPs; GAPs, Ras

Chromosomal Location of Human Ortholog: 19q13.1

Cellular Component: membrane; cytoplasm; plasma membrane

Molecular Function: diacylglycerol binding; GTP-dependent protein binding; calcium ion binding; Ras guanyl-nucleotide exchange factor activity

Biological Process: cell proliferation; phospholipase C activation; small GTPase mediated signal transduction; response to extracellular stimulus; myeloid cell differentiation; positive regulation of Ras protein signal transduction; cell growth; regulation of G-protein coupled receptor protein signaling pathway; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on RASGRP4

Similar Products

Product Notes

The RASGRP4 rasgrp4 (Catalog #AAA643583) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RASGRP4 (RAS Guanyl-releasing Protein 4) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RASGRP4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the RASGRP4 rasgrp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CGLCCHKHCR DQVKVECKKR PGAKGDAGPP GAPVPSTPAP HASCGSEENH SYTLSLEPET GCQLRHAWTQ TESPHPSWET DTVPCPVMDP PSTASSKLDS. It is sometimes possible for the material contained within the vial of "RASGRP4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.