Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RARA monoclonal antibody (M04), clone 4B3 Western Blot analysis of RARA expression in Hela S3 NE (Cat # L013V3).)

Mouse RARA Monoclonal Antibody | anti-RARA antibody

RARA (Retinoic Acid Receptor, alpha, NR1B1, RAR) (HRP)

Gene Names
RARA; RAR; NR1B1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
RARA; Monoclonal Antibody; RARA (Retinoic Acid Receptor; alpha; NR1B1; RAR) (HRP); Retinoic Acid Receptor; RAR; anti-RARA antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4B3
Specificity
Recognizes RARA.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-RARA antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RARA (NP_000955, 315aa-424aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLS
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RARA monoclonal antibody (M04), clone 4B3 Western Blot analysis of RARA expression in Hela S3 NE (Cat # L013V3).)

Western Blot (WB) (RARA monoclonal antibody (M04), clone 4B3 Western Blot analysis of RARA expression in Hela S3 NE (Cat # L013V3).)
Product Categories/Family for anti-RARA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14 kDa (127 aa), confirmed by MALDI-TOF. (Molecular weight on SDS-PAGE will appear higher)
NCBI Official Full Name
retinoic acid receptor alpha isoform 1
NCBI Official Synonym Full Names
retinoic acid receptor alpha
NCBI Official Symbol
RARA
NCBI Official Synonym Symbols
RAR; NR1B1
NCBI Protein Information
retinoic acid receptor alpha
UniProt Protein Name
Retinoic acid receptor alpha
Protein Family
UniProt Gene Name
RARA
UniProt Synonym Gene Names
NR1B1; RAR-alpha
UniProt Entry Name
RARA_HUMAN

NCBI Description

This gene represents a nuclear retinoic acid receptor. The encoded protein, retinoic acid receptor alpha, regulates transcription in a ligand-dependent manner. This gene has been implicated in regulation of development, differentiation, apoptosis, granulopoeisis, and transcription of clock genes. Translocations between this locus and several other loci have been associated with acute promyelocytic leukemia. Alternatively spliced transcript variants have been found for this locus.[provided by RefSeq, Sep 2010]

Uniprot Description

RARA: is a receptor for retinoic acid, a potent mammalian morphogen and teratogen that has profound effects on vertebrate development. RARA is a member of the nuclear receptor superfamily. Controls cell function by directly regulating gene expression. Its phosphorylation is crucial for transcriptional activity. Aberrations involving RARA may be a cause of acute promyelocytic leukemia. Two splice-variant isoforms have been described.

Protein type: Nuclear receptor; Transcription factor; Oncoprotein; DNA-binding

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: nucleoplasm; cell surface; cell soma; perinuclear region of cytoplasm; cytoplasm; nuclear chromatin; dendrite; nucleus; actin cytoskeleton

Molecular Function: protein domain specific binding; protein kinase B binding; retinoic acid binding; zinc ion binding; chromatin DNA binding; translation repressor activity, nucleic acid binding; transcription coactivator activity; drug binding; phosphoinositide 3-kinase regulator activity; alpha-actinin binding; transcription factor binding; protein binding; enzyme binding; protein heterodimerization activity; protein kinase A binding; steroid hormone receptor activity; mRNA 5'-UTR binding; retinoic acid receptor activity; transcription factor activity; transcription corepressor activity; receptor binding

Biological Process: prostate gland development; negative regulation of translational initiation; regulation of myelination; estrogen receptor signaling pathway; glandular epithelial cell development; positive regulation of transcription, DNA-dependent; regulation of synaptic plasticity; female pregnancy; protein amino acid phosphorylation; regulation of phosphoinositide 3-kinase activity; response to vitamin A; germ cell development; Sertoli cell fate commitment; positive regulation of T-helper 2 cell differentiation; positive regulation of cell cycle; positive regulation of phosphoinositide 3-kinase cascade; response to ethanol; positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling; negative regulation of transcription, DNA-dependent; negative regulation of apoptosis; limb development; retinoic acid receptor signaling pathway; ventricular cardiac muscle cell differentiation; negative regulation of transcription from RNA polymerase II promoter; signal transduction; response to estradiol stimulus; negative regulation of granulocyte differentiation; positive regulation of interleukin-4 production; negative regulation of cell proliferation; ureteric bud development; negative regulation of interferon-gamma production; positive regulation of cell proliferation; positive regulation of interleukin-13 production; transmembrane transport; positive regulation of interleukin-5 production; transcription initiation from RNA polymerase II promoter; response to retinoic acid; multicellular organism growth; positive regulation of binding; negative regulation of tumor necrosis factor production; liver development; embryonic camera-type eye development; positive regulation of protein kinase B signaling cascade; response to cytokine stimulus; neural tube closure; gene expression; spermatogenesis; positive regulation of neuron differentiation; apoptotic cell clearance

Disease: Acute Promyelocytic Leukemia

Research Articles on RARA

Similar Products

Product Notes

The RARA rara (Catalog #AAA6179904) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RARA can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RARA rara for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RARA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.