Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RAF1 expression in transfected 293T cell line by RAF1 monoclonal antibody. Lane 1: RAF1 transfected lysate (73.1kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human RAF1 Monoclonal Antibody | anti-RAF1 antibody

RAF1 (RAF Proto-oncogene Serine/Threonine-protein Kinase, Proto-oncogene c-RAF, Raf-1, C-RAF, cRaf, RAF) (HRP)

Gene Names
RAF1; NS5; CRAF; Raf-1; c-Raf; CMD1NN
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RAF1; Monoclonal Antibody; RAF1 (RAF Proto-oncogene Serine/Threonine-protein Kinase; Proto-oncogene c-RAF; Raf-1; C-RAF; cRaf; RAF) (HRP); anti-RAF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1H4
Specificity
Recognizes human RAF1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-RAF1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-130, from human RAF1 (AAH18119) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAASLIGEELQVDF
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RAF1 expression in transfected 293T cell line by RAF1 monoclonal antibody. Lane 1: RAF1 transfected lysate (73.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RAF1 expression in transfected 293T cell line by RAF1 monoclonal antibody. Lane 1: RAF1 transfected lysate (73.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of RAF1 over-expressed 293 cell line, cotransfected with RAF1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RAF1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of RAF1 over-expressed 293 cell line, cotransfected with RAF1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RAF1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between BAD and RAF1. HeLa cells were stained with BAD rabbit purified polyclonal 1:1200 and RAF1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between BAD and RAF1. HeLa cells were stained with BAD rabbit purified polyclonal 1:1200 and RAF1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between PDGFRB and RAF1. Huh7 cells were stained with PDGFRB rabbit purified polyclonal 1:600 and RAF1 mouse monoclonal antibody 1:100. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between PDGFRB and RAF1. Huh7 cells were stained with PDGFRB rabbit purified polyclonal 1:600 and RAF1 mouse monoclonal antibody 1:100. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-RAF1 antibody
Raf-1 is a MAP kinase kinase kinase (MAP3K) which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. Once activated Raf-1 can phosphorylate to activate the dual specificity protein kinases MEK1 and MEK2 which in turn phosphorylate to activate the serine/threonine specific protein kinases ERK1 and ERK2. Activated ERKs are pleiotropic effectors of cell physiology and play an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration.
Product Categories/Family for anti-RAF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
75,395 Da
NCBI Official Full Name
Homo sapiens v-raf-1 murine leukemia viral oncogene homolog 1, mRNA
NCBI Official Synonym Full Names
Raf-1 proto-oncogene, serine/threonine kinase
NCBI Official Symbol
RAF1
NCBI Official Synonym Symbols
NS5; CRAF; Raf-1; c-Raf; CMD1NN
NCBI Protein Information
RAF proto-oncogene serine/threonine-protein kinase
Protein Family

NCBI Description

This gene is the cellular homolog of viral raf gene (v-raf). The encoded protein is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. Once activated, the cellular RAF1 protein can phosphorylate to activate the dual specificity protein kinases MEK1 and MEK2, which in turn phosphorylate to activate the serine/threonine specific protein kinases, ERK1 and ERK2. Activated ERKs are pleiotropic effectors of cell physiology and play an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration. Mutations in this gene are associated with Noonan syndrome 5 and LEOPARD syndrome 2. [provided by RefSeq, Jul 2008]

Research Articles on RAF1

Similar Products

Product Notes

The RAF1 (Catalog #AAA6154511) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAF1 (RAF Proto-oncogene Serine/Threonine-protein Kinase, Proto-oncogene c-RAF, Raf-1, C-RAF, cRaf, RAF) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAF1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAF1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.