Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human RAET1E Monoclonal Antibody | anti-RAET1E antibody

RAET1E (Retinoic Acid Early Transcript 1E, NKG2D Ligand 4, N2DL4, N2DL-4, NKG2DL4, Lymphocyte Effector Toxicity Activation Ligand, LETAL, RAE-1-like Transcript 4, RL-4, ULBP4, UNQ1867/PRO4303) (MaxLight 550)

Gene Names
RAET1E; RL-4; LETAL; ULBP4; N2DL-4; NKG2DL4; RAET1E2; bA350J20.7
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RAET1E; Monoclonal Antibody; RAET1E (Retinoic Acid Early Transcript 1E; NKG2D Ligand 4; N2DL4; N2DL-4; NKG2DL4; Lymphocyte Effector Toxicity Activation Ligand; LETAL; RAE-1-like Transcript 4; RL-4; ULBP4; UNQ1867/PRO4303) (MaxLight 550); bA350J20.7; MGC125308; MGC125309; RAET1E2; anti-RAET1E antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D11
Specificity
Recognizes human RAET1E.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-RAET1E antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa36-146 from human RAET1E (NP_631904) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLLGKKVNATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGE
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-RAET1E antibody
MaxLight550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor546, 555, DyLight549, Cy3, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
Product Categories/Family for anti-RAET1E antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,300 Da
NCBI Official Full Name
retinoic acid early transcript 1E isoform 1
NCBI Official Synonym Full Names
retinoic acid early transcript 1E
NCBI Official Symbol
RAET1E
NCBI Official Synonym Symbols
RL-4; LETAL; ULBP4; N2DL-4; NKG2DL4; RAET1E2; bA350J20.7
NCBI Protein Information
retinoic acid early transcript 1E
UniProt Protein Name
NKG2D ligand 4
UniProt Gene Name
RAET1E
UniProt Synonym Gene Names
LETAL; N2DL4; ULBP4; N2DL-4; NKG2DL4; RL-4
UniProt Entry Name
N2DL4_HUMAN

NCBI Description

This gene belong to the RAET1 family, which consists of major histocompatibility complex (MHC) class I-related genes located in a cluster on chromosome 6q24.2-q25.3. This and RAET1G protein differ from other RAET1 proteins in that they have type I membrane-spanning sequences at their C termini rather than glycosylphosphatidylinositol anchor sequences. This protein functions as a ligand for NKG2D receptor, which is expressed on the surface of several types of immune cells, and is involved in innate and adaptive immune responses. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2011]

Uniprot Description

RAET1E: Ligand for the NKG2D receptor. Delivers activating signals to NK cells and promotes tumor immune surveillance by inducing the expansion of anti-tumor cytotoxic lymphocytes. Belongs to the MHC class I family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 6q25.1

Cellular Component: plasma membrane

Molecular Function: antigen binding; natural killer cell lectin-like receptor binding

Biological Process: antigen processing and presentation; natural killer cell mediated cytotoxicity; regulation of immune response; T cell mediated cytotoxicity

Research Articles on RAET1E

Similar Products

Product Notes

The RAET1E raet1e (Catalog #AAA6213512) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAET1E (Retinoic Acid Early Transcript 1E, NKG2D Ligand 4, N2DL4, N2DL-4, NKG2DL4, Lymphocyte Effector Toxicity Activation Ligand, LETAL, RAE-1-like Transcript 4, RL-4, ULBP4, UNQ1867/PRO4303) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAET1E can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAET1E raet1e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAET1E, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.