Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human RAD54L Monoclonal Antibody | anti-RAD54L antibody

RAD54L (DNA Repair and Recombination Protein RAD54-like, HR54, hHR54, RAD54 Homolog, hRAD54, RAD54A) (HRP)

Gene Names
RAD54L; HR54; hHR54; RAD54A; hRAD54
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RAD54L; Monoclonal Antibody; RAD54L (DNA Repair and Recombination Protein RAD54-like; HR54; hHR54; RAD54 Homolog; hRAD54; RAD54A) (HRP); EC=3.6.4.-; anti-RAD54L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
4G2
Specificity
Recognizes human RAD54L.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-RAD54L antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa638-748 from RAD54L (NP_003570) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KKALSSCVVDEEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQHSHEEQRGLR
Conjugate
HRP
Preparation and Storage
May be stored at 4 degree C. For long-term storage, aliquot and store at 4 degree C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)
Product Categories/Family for anti-RAD54L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84kDa
NCBI Official Full Name
DNA repair and recombination protein RAD54-like
NCBI Official Synonym Full Names
RAD54 like
NCBI Official Symbol
RAD54L
NCBI Official Synonym Symbols
HR54; hHR54; RAD54A; hRAD54
NCBI Protein Information
DNA repair and recombination protein RAD54-like
UniProt Protein Name
DNA repair and recombination protein RAD54-like
UniProt Gene Name
RAD54L
UniProt Synonym Gene Names
RAD54A; hHR54; hRAD54
UniProt Entry Name
RAD54_HUMAN

NCBI Description

The protein encoded by this gene belongs to the DEAD-like helicase superfamily, and shares similarity with Saccharomyces cerevisiae Rad54, a protein known to be involved in the homologous recombination and repair of DNA. This protein has been shown to play a role in homologous recombination related repair of DNA double-strand breaks. The binding of this protein to double-strand DNA induces a DNA topological change, which is thought to facilitate homologous DNA paring, and stimulate DNA recombination. Alternative splicing results in multiple transcript variants encoding the same protein.[provided by RefSeq, Dec 2008]

Uniprot Description

RAD54L: Involved in DNA repair and mitotic recombination. Functions in the recombinational DNA repair (RAD52) pathway. Dissociates RAD51 from nucleoprotein filaments formed on dsDNA. Could be involved in the turnover of RAD51 protein-dsDNA filaments. May play also an essential role in telomere length maintenance and telomere capping in mammalian cells. Belongs to the SNF2/RAD54 helicase family.

Protein type: Cell cycle regulation; DNA repair, damage; EC 3.6.4.-; Helicase; EC 3.6.1.-

Chromosomal Location of Human Ortholog: 1p32

Cellular Component: nucleoplasm; nucleus

Molecular Function: protein binding; DNA binding; helicase activity; ATP binding

Biological Process: response to drug; meiosis; DNA strand renaturation; response to ionizing radiation; DNA repair; chromosome organization and biogenesis; double-strand break repair via homologous recombination; DNA recombination

Disease: Lymphoma, Non-hodgkin, Familial; Breast Cancer

Research Articles on RAD54L

Similar Products

Product Notes

The RAD54L rad54l (Catalog #AAA6154509) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAD54L (DNA Repair and Recombination Protein RAD54-like, HR54, hHR54, RAD54 Homolog, hRAD54, RAD54A) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAD54L can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAD54L rad54l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAD54L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.