Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human RABEPK Monoclonal Antibody | anti-RABEPK antibody

RABEPK (Rab9 Effector Protein with Kelch Motifs, 40kD Rab9 Effector Protein, p40, RAB9P40) (Biotin)

Gene Names
RABEPK; p40; RAB9P40; bA65N13.1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RABEPK; Monoclonal Antibody; RABEPK (Rab9 Effector Protein with Kelch Motifs; 40kD Rab9 Effector Protein; p40; RAB9P40) (Biotin); anti-RABEPK antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C9
Specificity
Recognizes human RABEPK.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1671
Applicable Applications for anti-RABEPK antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa273-372 from RABEPK (NP_005824) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YHTEEQHWTLLKFDTLLPPGRLDHSMCIIPWPVTCASEKEDSNSLTLNHEAEKEDSADKVMSHSGDSHEESQTATLLCLVFGGMNTEGEIYDDCIVTVVD
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged RABEPK is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RABEPK is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-RABEPK antibody
Rab9 effector required for endosome to trans-Golgi network (TGN) transport.
Product Categories/Family for anti-RABEPK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens Rab9 effector protein with kelch motifs (RABEPK), transcript variant 1, mRNA
NCBI Official Synonym Full Names
Rab9 effector protein with kelch motifs
NCBI Official Symbol
RABEPK
NCBI Official Synonym Symbols
p40; RAB9P40; bA65N13.1
NCBI Protein Information
rab9 effector protein with kelch motifs
UniProt Protein Name
Rab9 effector protein with kelch motifs
UniProt Gene Name
RABEPK
UniProt Synonym Gene Names
RAB9P40
UniProt Entry Name
RABEK_HUMAN

Uniprot Description

RABEPK: Rab9 effector required for endosome to trans-Golgi network (TGN) transport. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 9q33.3

Cellular Component: intracellular membrane-bound organelle; plasma membrane; endosome membrane; endosome

Biological Process: receptor-mediated endocytosis; vesicle docking during exocytosis

Research Articles on RABEPK

Similar Products

Product Notes

The RABEPK rabepk (Catalog #AAA6143887) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RABEPK (Rab9 Effector Protein with Kelch Motifs, 40kD Rab9 Effector Protein, p40, RAB9P40) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RABEPK can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RABEPK rabepk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RABEPK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.