Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human RABEP1 Monoclonal Antibody | anti-RABEP1 antibody

RABEP1 (Rab GTPase-binding Effector Protein 1, Rabaptin-4, Rabaptin-5, Rabaptin-5alpha, Renal Carcinoma Antigen NY-REN-17, RAB5EP, RABPT5, RABPT5A) (Biotin)

Gene Names
RABEP1; RAB5EP; RABPT5
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RABEP1; Monoclonal Antibody; RABEP1 (Rab GTPase-binding Effector Protein 1; Rabaptin-4; Rabaptin-5; Rabaptin-5alpha; Renal Carcinoma Antigen NY-REN-17; RAB5EP; RABPT5; RABPT5A) (Biotin); anti-RABEP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3H6
Specificity
Recognizes human RABEP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
5909
Applicable Applications for anti-RABEP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa765-863 from RABEP1 (NP_004694) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KSQQLESLQEIKISLEEQLKKETAAKATVEQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQVQLERIRQADSLERIRAILNDTKLTDINQLPET
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(RABEP1 monoclonal antibody Western Blot analysis of RABEP1 expression in HepG2.)

Western Blot (WB) (RABEP1 monoclonal antibody Western Blot analysis of RABEP1 expression in HepG2.)
Related Product Information for anti-RABEP1 antibody
Rab effector protein acting as linker between gamma-adaptin, RAB4A and RAB5A. Involved in endocytic membrane fusion and membrane trafficking of recycling endosomes. Stimulates RABGEF1 mediated nucleotide exchange on RAB5A.
Product Categories/Family for anti-RABEP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens rabaptin, RAB GTPase binding effector protein 1 (RABEP1), transcript variant 1, mRNA
NCBI Official Synonym Full Names
rabaptin, RAB GTPase binding effector protein 1
NCBI Official Symbol
RABEP1
NCBI Official Synonym Symbols
RAB5EP; RABPT5
NCBI Protein Information
rab GTPase-binding effector protein 1
UniProt Protein Name
Rab GTPase-binding effector protein 1
UniProt Gene Name
RABEP1
UniProt Synonym Gene Names
RAB5EP; RABPT5; RABPT5A
UniProt Entry Name
RABE1_HUMAN

Uniprot Description

RABEP1: Rab effector protein acting as linker between gamma- adaptin, RAB4A and RAB5A. Involved in endocytic membrane fusion and membrane trafficking of recycling endosomes. Stimulates RABGEF1 mediated nucleotide exchange on RAB5A. Belongs to the rabaptin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 17p13.2

Cellular Component: recycling endosome; intracellular membrane-bound organelle; endocytic vesicle; early endosome; endosome

Molecular Function: protein binding; protein homodimerization activity; growth factor activity; GTPase activator activity

Biological Process: vesicle-mediated transport; protein transport; apoptosis; endocytosis; positive regulation of GTPase activity

Research Articles on RABEP1

Similar Products

Product Notes

The RABEP1 rabep1 (Catalog #AAA6143886) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RABEP1 (Rab GTPase-binding Effector Protein 1, Rabaptin-4, Rabaptin-5, Rabaptin-5alpha, Renal Carcinoma Antigen NY-REN-17, RAB5EP, RABPT5, RABPT5A) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RABEP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RABEP1 rabep1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RABEP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.