Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged RAB9A is approximately 1ng/ml as a capture antibody.)

Mouse RAB9A Monoclonal Antibody | anti-RAB9A antibody

RAB9A (RAB9A, Member RAS Oncogene Family, RAB9) (PE)

Gene Names
RAB9A; RAB9
Applications
Western Blot
Purity
Purified
Synonyms
RAB9A; Monoclonal Antibody; RAB9A (RAB9A; Member RAS Oncogene Family; RAB9) (PE); RAB9; anti-RAB9A antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4F8
Specificity
Recognizes RAB9A.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-RAB9A antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RAB9A (NP_004242, 17aa-115aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPE
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RAB9A is approximately 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RAB9A is approximately 1ng/ml as a capture antibody.)
Related Product Information for anti-RAB9A antibody
Mouse monoclonal antibody raised against a partial recombinant RAB9A.
Product Categories/Family for anti-RAB9A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
ras-related protein Rab-9A
NCBI Official Synonym Full Names
RAB9A, member RAS oncogene family
NCBI Official Symbol
RAB9A
NCBI Official Synonym Symbols
RAB9
NCBI Protein Information
ras-related protein Rab-9A
UniProt Protein Name
Ras-related protein Rab-9A
Protein Family
UniProt Gene Name
RAB9A
UniProt Synonym Gene Names
RAB9
UniProt Entry Name
RAB9A_HUMAN

Uniprot Description

RAB9A: Involved in the transport of proteins between the endosomes and the trans Golgi network. Interacts (preferentially in its GTP-bound form) with GCC2 (via its GRIP domain). Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein; G protein, monomeric, Rab; G protein, monomeric

Chromosomal Location of Human Ortholog: Xp22.2

Cellular Component: Golgi membrane; phagocytic vesicle membrane; endoplasmic reticulum membrane; lysosome; late endosome; vacuolar membrane; plasma membrane; phagocytic vesicle

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding

Biological Process: intracellular protein transport; metabolic process; Rab protein signal transduction; retrograde transport, endosome to Golgi; positive regulation of exocytosis

Research Articles on RAB9A

Similar Products

Product Notes

The RAB9A rab9a (Catalog #AAA6184975) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RAB9A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAB9A rab9a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAB9A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.