Mouse anti-Human RAB8A Monoclonal Antibody | anti-RAB8A antibody

RAB8A (Oncogene c-mel, Ras-related Protein Rab-8A, MEL, RAB8) (AP)

Cat. Num. AAA6133275

• Gene Names: RAB8A; MEL; RAB8
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RAB8A; Monoclonal Antibody; RAB8A (Oncogene c-mel; Ras-related Protein Rab-8A; MEL; RAB8) (AP); anti-RAB8A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3G1
• Specificity: Recognizes human RAB8A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-RAB8A antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa108-207 from human RAB8A with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of RAB8A expression in Hela cells, using 132223.)

Testing Data

(Detection limit for recombinant GST tagged RAB8A is ~0.1ng/ml as a capture antibody.)

Testing Data

()

Related Product Information for anti-RAB8A antibody

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. Anessential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. RAB8A is a member of the peptidase T1A family, that is a 20S core alpha subunit. A pseudogene has been identified on the Y chromosome.

Product Categories/Family for anti-RAB8A antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 12804236
• NCBI GeneID: 4218
• Molecular Weight: 23,564 Da
• NCBI Official Full Name: Homo sapiens RAB8A, member RAS oncogene family, mRNA
• NCBI Official Synonym Full Names: RAB8A, member RAS oncogene family
• NCBI Official Symbol: RAB8A
• NCBI Official Synonym Symbols: MEL; RAB8
• NCBI Protein Information: ras-related protein Rab-8A
• Protein Family: Ras-related protein

NCBI Description

The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1. [provided by RefSeq, Jul 2008]