Mouse anti-Human RAB7B Monoclonal Antibody | anti-RAB7B antibody

RAB7B (Ras-related Protein Rab-7b, RAB7) (HRP)

Cat. Num. AAA6154485

• Gene Names: RAB7B; RAB7
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RAB7B; Monoclonal Antibody; RAB7B (Ras-related Protein Rab-7b; RAB7) (HRP); MGC16212; MGC9726; anti-RAB7B antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B3
• Specificity: Recognizes human RAB7B.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 199

• Applicable Applications for anti-RAB7B antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody.; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa100-200 from human RAB7B (NP_796377) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(RAB7B monoclonal antibody. Western Blot analysis of RAB7B expression in human kidney.)

Western Blot (WB)

(Western Blot analysis of RAB7B expression in transfected 293T cell line by RAB7B monoclonal antibody. Lane 1: RAB7B transfected lysate (22.5kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of RAB7B transfected lysate using RAB7B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RAB7B rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged RAB7B is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(RAB7B monoclonal antibody. Western Blot analysis of RAB7B expression in A-431.)

Product Categories/Family for anti-RAB7B antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

References

1. Zlatic SA, Tornieri K, L'hernault SW, Faundez V.Mol Biol Cell. 2011 May;22(10):1699-715. Epub 2011 Mar 16. 2. Higashi S, Moore DJ, Yamamoto R, Minegishi M, Sato K, Togo T, Katsuse O, Uchikado H, Furukawa Y, Hino H, Kosaka K, Emson PC, Wada K, Dawson VL, Dawson TM, Arai H, Iseki E.J Neuropathol Exp Neurol. 2009 Sep;68(9):994-1005. 3.GIGYF2 is present in endosomal compartments in the mammalian brains and enhances IGF-1-induced ERK1/2 activation. Higashi S, Iseki E, Minegishi M, Togo T, Kabuta T, Wada K.J Neurochem. 2010 Jul 28. 4. Zhu GD, Salazar G, Zlatic SA, Fiza B, Doucette MM, Heilman CJ, Levey AI, Faundez V, L'hernault SW.Mol Biol Cell. 2009 Feb;20(4):1223-1240. Epub 2008 Dec 24.

NCBI and Uniprot Product Information

• NCBI GI #: 256985158
• NCBI GeneID: 338382
• NCBI Accession #: NP_796377
• NCBI GenBank Nucleotide #: NM_177403
• UniProt Accession #: Q96AH8
• NCBI Official Full Name: ras-related protein Rab-7b isoform a
• NCBI Official Synonym Full Names: RAB7B, member RAS oncogene family
• NCBI Official Symbol: RAB7B
• NCBI Official Synonym Symbols: RAB7
• NCBI Protein Information: ras-related protein Rab-7b
• UniProt Protein Name: Ras-related protein Rab-7b
• Protein Family: Ras-related protein
• UniProt Gene Name: RAB7B
• UniProt Entry Name: RAB7B_HUMAN

Uniprot Description

RAB7B: Controls vesicular trafficking from endosomes to the trans-Golgi network (TGN). Acts as a negative regulator of TLR9 signaling and can suppress TLR9-triggered TNFA, IL6, and IFNB production in macrophages by promoting TLR9 lysosomal degradation. Also negatively regulates TLR4 signaling in macrophages by promoting lysosomal degradation of TLR4. Promotes megakaryocytic differentiation by increasing NF-kappa-B-dependent IL6 production and subsequently enhancing the association of STAT3 with GATA1. Not involved in the regulation of the EGF- and EGFR degradation pathway. Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein; G protein, monomeric, Rab; G protein, monomeric

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: Golgi apparatus; phagocytic vesicle membrane; lysosome; late endosome; trans-Golgi network; phagocytic vesicle

Molecular Function: GTP binding

Biological Process: negative regulation of toll-like receptor 9 signaling pathway; protein transport; small GTPase mediated signal transduction; negative regulation of toll-like receptor 4 signaling pathway; positive regulation of interleukin-6 production; positive regulation of megakaryocyte differentiation; activation of NF-kappaB transcription factor