Mouse anti-Human RAB42 Monoclonal Antibody | anti-RAB42 antibody

RAB42 (Putative Ras-related Protein, Rab-42, RP4-669K10.6)

Cat. Num. AAA6011910

• Gene Names: RAB42; RP4-669K10.6
• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: RAB42; Monoclonal Antibody; RAB42 (Putative Ras-related Protein; Rab-42; RP4-669K10.6); Anti -RAB42 (Putative Ras-related Protein; anti-RAB42 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3A2
• Specificity: Recognizes human RAB42.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: SVKNNCNVDLAFDTLADAIQQALQQGDIKLEEGWGGVRLIHKTQIPRSPSRKQHSGPCQC

• Applicable Applications for anti-RAB42 antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.; Dilution: Immunofluorescence: 10ug/ml; Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Partial recombinant corresponding to aa46-106 from human RAB42 (NP_689517) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.71kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RAB42 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RAB42 on HeLa cell . [antibody concentration 10ug/ml].)

Product Categories/Family for anti-RAB42 antibody

Antibodies; Abs to GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 119628090
• NCBI GeneID: 115273
• UniProt Accession #: Q8N4Z0; B2R5G2
• Molecular Weight: 11,364 Da
• NCBI Official Full Name: RAB42, member RAS homolog family, isoform CRA_b
• NCBI Official Synonym Full Names: RAB42, member RAS oncogene family
• NCBI Official Symbol: RAB42
• NCBI Official Synonym Symbols: RP4-669K10.6
• NCBI Protein Information: putative Ras-related protein Rab-42; RAB42, member RAS homolog family
• UniProt Protein Name: Putative Ras-related protein Rab-42
• Protein Family: Putative Ras-related protein
• UniProt Gene Name: RAB42
• UniProt Entry Name: RAB42_HUMAN

Uniprot Description

RAB42: Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein, monomeric, Rab; G protein, monomeric

Chromosomal Location of Human Ortholog: 1p35.3

Cellular Component: Golgi apparatus; membrane

Molecular Function: GTPase activity; GDP binding; GTP binding

Biological Process: intracellular protein transport; metabolic process; Rab protein signal transduction