Western Blot (WB)
(Western Blot analysis of RAB3B expression in transfected 293T cell line by RAB3B monoclonal antibody (M02), clone 1A7.Lane 1: RAB3B transfected lysate (24.8 KDa).Lane 2: Non-transfected lysate.)
Mouse RAB3B Monoclonal Antibody | anti-RAB3B antibody
RAB3B (RAB3B, Member RAS Oncogene Family) (APC)
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
RAB3B; Monoclonal Antibody; RAB3B (RAB3B; Member RAS Oncogene Family) (APC); Member RAS Oncogene Family; anti-RAB3B antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A7
Specificity
Recognizes RAB3B.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
219
Applicable Applications for anti-RAB3B antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RAB3B (AAH05035, 120aa-219aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGSSKNTRLSDTPPLLQQNCSC
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of RAB3B expression in transfected 293T cell line by RAB3B monoclonal antibody (M02), clone 1A7.Lane 1: RAB3B transfected lysate (24.8 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of RAB3B expression in transfected 293T cell line by RAB3B monoclonal antibody (M02), clone 1A7.Lane 1: RAB3B transfected lysate (24.8 KDa).Lane 2: Non-transfected lysate.)
Immunoprecipitation (IP)
(Immunoprecipitation of RAB3B transfected lysate using anti-RAB3B monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with RAB3B MaxPab rabbit polyclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of RAB3B transfected lysate using anti-RAB3B monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with RAB3B MaxPab rabbit polyclonal antibody.)
Related Product Information for anti-RAB3B antibody
Mouse monoclonal antibody raised against a partial recombinant RAB3B.
Product Categories/Family for anti-RAB3B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
RAB3B, member RAS oncogene family
NCBI Official Synonym Full Names
RAB3B, member RAS oncogene family
NCBI Official Symbol
RAB3B
NCBI Protein Information
ras-related protein Rab-3B
Protein Family
Research Articles on RAB3B
Similar Products
Product Notes
The RAB3B (Catalog #AAA6169510) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RAB3B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAB3B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAB3B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
