Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human RAB3A Monoclonal Antibody | anti-RAB3A antibody

RAB3A (Ras-related Protein Rab-3A) (MaxLight 550)

Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RAB3A; Monoclonal Antibody; RAB3A (Ras-related Protein Rab-3A) (MaxLight 550); anti-RAB3A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4H7
Specificity
Recognizes human RAB3A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-RAB3A antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 25ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa122-221, from human RAB3A, (NP_002857) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-RAB3A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27.1 kDa (240aa), confirmed by MALDI-TOF
NCBI Official Full Name
ras-related protein Rab-3A
NCBI Official Synonym Full Names
RAB3A, member RAS oncogene family
NCBI Official Symbol
RAB3A
NCBI Protein Information
ras-related protein Rab-3A
UniProt Protein Name
Ras-related protein Rab-3A
Protein Family
UniProt Gene Name
RAB3A
UniProt Entry Name
RAB3A_HUMAN

Uniprot Description

RAB3A: Involved in exocytosis by regulating a late step in synaptic vesicle fusion. Could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal. Heterodimer with RIMS2. Part of a ternary complex involving PCLO and EPAC2. Interacts with RPH3A. Interacts with the exocyst complex through SEC15. Binds SYTL4, RIMS1 and RIMS2. Interacts with RAB3IP. Interacts with SGSM1 and SGSM3. Specifically expressed in brain. Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein; G protein, monomeric, Rab; G protein, monomeric

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: synaptic vesicle; protein complex; secretory granule membrane; axon; acrosome; plasma membrane; terminal button; cytosol; vesicle; endosome

Molecular Function: GTPase activity; protein C-terminus binding; protein binding; GTPase binding; ATPase activator activity; GDP binding; GTP binding; myosin V binding; ATPase binding

Biological Process: mitochondrion organization and biogenesis; synaptic vesicle maturation; metabolic process; neurotransmitter secretion; regulation of synaptic vesicle fusion to presynaptic membrane; constitutive secretory pathway; protein secretion; regulation of short-term neuronal synaptic plasticity; post-embryonic development; respiratory system process; intracellular protein transport; synaptic transmission; synaptic vesicle exocytosis; axonogenesis; glutamate secretion; sensory perception of touch; positive regulation of ATPase activity; neuromuscular synaptic transmission; maintenance of presynaptic active zone structure; response to electrical stimulus; Rab protein signal transduction; vesicle docking during exocytosis; positive regulation of exocytosis; lung development

Research Articles on RAB3A

Similar Products

Product Notes

The RAB3A rab3a (Catalog #AAA6213480) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAB3A (Ras-related Protein Rab-3A) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAB3A can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 25ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAB3A rab3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAB3A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.