Mouse anti-Human RAB3A Monoclonal Antibody | anti-RAB3A antibody

RAB3A (Ras-related Protein Rab-3A) (HRP)

Cat. Num. AAA6154478

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RAB3A; Monoclonal Antibody; RAB3A (Ras-related Protein Rab-3A) (HRP); anti-RAB3A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4H7
• Specificity: Recognizes human RAB3A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-RAB3A antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa122-221, from human RAB3A, (NP_002857) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RAB3A monoclonal antibody, Western Blot analysis of RAB3A expression in IMR-32.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RAB3A on HeLa cell. [antibody concentration 25ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RAB3A is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-RAB3A antibody

Involved in exocytosis by regulating a late step in synaptic vesicle fusion. Could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal.

Product Categories/Family for anti-RAB3A antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4506367
• NCBI GeneID: 5864
• NCBI Accession #: NP_002857
• NCBI GenBank Nucleotide #: NM_002866
• UniProt Accession #: P20336; Q9NYE1; A8K0J4
• Molecular Weight: 27.1 kDa (240aa), confirmed by MALDI-TOF
• NCBI Official Full Name: ras-related protein Rab-3A
• NCBI Official Synonym Full Names: RAB3A, member RAS oncogene family
• NCBI Official Symbol: RAB3A
• NCBI Protein Information: ras-related protein Rab-3A
• UniProt Protein Name: Ras-related protein Rab-3A
• Protein Family: Ras-related protein
• UniProt Gene Name: RAB3A
• UniProt Entry Name: RAB3A_HUMAN

Uniprot Description

RAB3A: Involved in exocytosis by regulating a late step in synaptic vesicle fusion. Could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal. Heterodimer with RIMS2. Part of a ternary complex involving PCLO and EPAC2. Interacts with RPH3A. Interacts with the exocyst complex through SEC15. Binds SYTL4, RIMS1 and RIMS2. Interacts with RAB3IP. Interacts with SGSM1 and SGSM3. Specifically expressed in brain. Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein; G protein, monomeric, Rab; G protein, monomeric

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: synaptic vesicle; protein complex; secretory granule membrane; axon; acrosome; plasma membrane; terminal button; cytosol; vesicle; endosome

Molecular Function: GTPase activity; protein C-terminus binding; protein binding; GTPase binding; ATPase activator activity; GDP binding; GTP binding; myosin V binding; ATPase binding

Biological Process: mitochondrion organization and biogenesis; synaptic vesicle maturation; metabolic process; neurotransmitter secretion; regulation of synaptic vesicle fusion to presynaptic membrane; constitutive secretory pathway; protein secretion; regulation of short-term neuronal synaptic plasticity; post-embryonic development; respiratory system process; intracellular protein transport; synaptic transmission; synaptic vesicle exocytosis; axonogenesis; glutamate secretion; sensory perception of touch; positive regulation of ATPase activity; neuromuscular synaptic transmission; maintenance of presynaptic active zone structure; response to electrical stimulus; Rab protein signal transduction; vesicle docking during exocytosis; positive regulation of exocytosis; lung development