Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (49.54kD).)

Mouse anti-Human RAB39B Monoclonal Antibody | anti-RAB39B antibody

RAB39B (Ras-related Protein Rab-39B, MRX72) (AP)

Gene Names
RAB39B; WSMN; MRX72
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RAB39B; Monoclonal Antibody; RAB39B (Ras-related Protein Rab-39B; MRX72) (AP); anti-RAB39B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1E11
Specificity
Recognizes human RAB39B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-RAB39B antibody
ELISA (EIA), Western Blot (WB)
Application Notes
ELISA: 0.1ng/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-214 from human RAB39B (AAH09714) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLC
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (49.54kD).)

Western Blot (WB) (Western Blot detection against Immunogen (49.54kD).)

Western Blot (WB)

(Western Blot analysis of RAB39B expression in transfected 293T cell line by RAB39B monoclonal antibody. Lane 1: RAB39B transfected lysate (25kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RAB39B expression in transfected 293T cell line by RAB39B monoclonal antibody. Lane 1: RAB39B transfected lysate (25kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged RAB39B is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RAB39B is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-RAB39B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
24,622 Da
NCBI Official Full Name
Homo sapiens RAB39B, member RAS oncogene family, mRNA
NCBI Official Synonym Full Names
RAB39B, member RAS oncogene family
NCBI Official Symbol
RAB39B
NCBI Official Synonym Symbols
WSMN; MRX72
NCBI Protein Information
ras-related protein Rab-39B
Protein Family

NCBI Description

This gene encodes a member of the Rab family of proteins. Rab proteins are small GTPases that are involved in vesicular trafficking. Mutations in this gene are associated with X-linked mental retardation. [provided by RefSeq, Aug 2013]

Research Articles on RAB39B

Similar Products

Product Notes

The RAB39B (Catalog #AAA6133265) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAB39B (Ras-related Protein Rab-39B, MRX72) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAB39B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). ELISA: 0.1ng/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAB39B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAB39B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.