Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RAB27A monoclonal antibody (M01), clone 4C1. Western Blot analysis of RAB27A expression in HL-60 (Cat # L014V1).)

Mouse RAB27A Monoclonal Antibody | anti-RAB27A antibody

RAB27A (RAB27A, Member RAS Oncogene Family, GS2, HsT18676, MGC117246, RAB27, RAM) (HRP)

Gene Names
RAB27A; GS2; RAM; RAB27; HsT18676
Applications
Western Blot
Purity
Purified
Synonyms
RAB27A; Monoclonal Antibody; RAB27A (RAB27A; Member RAS Oncogene Family; GS2; HsT18676; MGC117246; RAB27; RAM) (HRP); RAM; anti-RAB27A antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4C1
Specificity
Recognizes RAB27A.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-RAB27A antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RAB27A (NP_004571, 122aa-221aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RAB27A monoclonal antibody (M01), clone 4C1. Western Blot analysis of RAB27A expression in HL-60 (Cat # L014V1).)

Western Blot (WB) (RAB27A monoclonal antibody (M01), clone 4C1. Western Blot analysis of RAB27A expression in HL-60 (Cat # L014V1).)

Testing Data

(Detection limit for recombinant GST tagged RAB27A is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RAB27A is approximately 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-RAB27A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
ras-related protein Rab-27A
NCBI Official Synonym Full Names
RAB27A, member RAS oncogene family
NCBI Official Symbol
RAB27A
NCBI Official Synonym Symbols
GS2; RAM; RAB27; HsT18676
NCBI Protein Information
ras-related protein Rab-27A
UniProt Protein Name
Ras-related protein Rab-27A
Protein Family
UniProt Gene Name
RAB27A
UniProt Synonym Gene Names
RAB27; Rab-27
UniProt Entry Name
RB27A_HUMAN

NCBI Description

The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscelli syndrome type 2. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

RAB27A: Plays a role in cytotoxic granule exocytosis in lymphocytes. Required for both granule maturation and granule docking and priming at the immunologic synapse. Defects in RAB27A are a cause of Griscelli syndrome type 2 (GS2). Griscelli syndrome is a rare autosomal recessive disorder that results in pigmentary dilution of the skin and hair, the presence of large clumps of pigment in hair shafts, and an accumulation of melanosomes in melanocytes. GS2 patients also develop an uncontrolled T-lymphocyte and macrophage activation syndrome, known as hemophagocytic syndrome, leading to death in the absence of bone marrow transplantation. Neurological impairment is present in some patients, likely as a result of hemophagocytic syndrome. Belongs to the small GTPase superfamily. Rab family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: G protein, monomeric; G protein, monomeric, Rab

Chromosomal Location of Human Ortholog: 15q15-q21.1

Cellular Component: Golgi apparatus; photoreceptor outer segment; lysosome; secretory granule membrane; apical plasma membrane; dendrite; late endosome; melanosome; secretory granule

Molecular Function: GTPase activity; protein domain specific binding; protein binding; GDP binding; GTP binding; myosin V binding

Biological Process: exocytosis; natural killer cell degranulation; cytotoxic T cell degranulation; melanosome localization; protein secretion; synaptic vesicle transport; melanosome transport; antigen processing and presentation; intracellular protein transport; cellular protein metabolic process; positive regulation of phagocytosis; melanocyte differentiation; Rab protein signal transduction; blood coagulation; vesicle docking during exocytosis; protein targeting; positive regulation of exocytosis

Disease: Griscelli Syndrome, Type 2

Research Articles on RAB27A

Similar Products

Product Notes

The RAB27A rab27a (Catalog #AAA6181400) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RAB27A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAB27A rab27a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAB27A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.