Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse RAB21 Monoclonal Antibody | anti-RAB21 antibody

RAB21 (RAB21, Member RAS Oncogene Family, KIAA0118) (MaxLight 650)

Applications
Western Blot
Purity
Purified
Synonyms
RAB21; Monoclonal Antibody; RAB21 (RAB21; Member RAS Oncogene Family; KIAA0118) (MaxLight 650); KIAA0118; anti-RAB21 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1G4
Specificity
Recognizes RAB21.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-RAB21 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RAB21 (NP_055814, 116aa-225aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-RAB21 antibody
RAB21 belongs to the RAB family of small GTP-binding proteins that regulate intracellular vesicle targeting (Opdam et al., 2000 [PubMed 10887961]). [supplied by OMIM]
Product Categories/Family for anti-RAB21 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,348 Da
NCBI Official Full Name
ras-related protein Rab-21
NCBI Official Synonym Full Names
RAB21, member RAS oncogene family
NCBI Official Symbol
RAB21
NCBI Protein Information
ras-related protein Rab-21
UniProt Protein Name
Ras-related protein Rab-21
Protein Family
UniProt Gene Name
RAB21
UniProt Synonym Gene Names
KIAA0118
UniProt Entry Name
RAB21_HUMAN

NCBI Description

This gene belongs to the Rab family of monomeric GTPases, which are involved in the control of cellular membrane traffic. The encoded protein plays a role in the targeted trafficking of integrins via its association with integrin alpha tails. As a consequence, the encoded protein is involved in the regulation of cell adhesion and migration. [provided by RefSeq, Aug 2013]

Uniprot Description

RAB21: Regulates integrin internalization and recycling, but does not influence the traffic of endosomally translocated receptors in general. As a result, may regulate cell adhesion and migration. During the mitosis of adherent cells, controls the endosomal trafficking of integrins which is required for the successful completion of cytokinesis. Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein, monomeric; Motility/polarity/chemotaxis; G protein, monomeric, Rab

Chromosomal Location of Human Ortholog: 12q21.1

Cellular Component: endoplasmic reticulum membrane; internal side of plasma membrane; focal adhesion; cytoplasmic vesicle membrane; early endosome; vesicle membrane; trans-Golgi network; endosome; cleavage furrow

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding

Biological Process: regulation of exocytosis; intracellular protein transport; metabolic process; regulation of endocytosis; Rab protein signal transduction; positive regulation of receptor-mediated endocytosis

Research Articles on RAB21

Similar Products

Product Notes

The RAB21 rab21 (Catalog #AAA6229538) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RAB21 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAB21 rab21 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAB21, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.