Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Mouse anti-Human RAB11FIP5 Monoclonal Antibody | anti-RAB11FIP5 antibody
RAB11FIP5 (Rab11 Family-interacting Protein 5, Rab11-FIP5, Gamma-SNAP-associated Factor 1, GAF1, Gaf-1, KIAA0857, Phosphoprotein pp75, pp75, Rab11-interacting Protein Rip11, RIP11) (MaxLight 750)
Gene Names
RAB11FIP5; GAF1; pp75; RIP11
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RAB11FIP5; Monoclonal Antibody; RAB11FIP5 (Rab11 Family-interacting Protein 5; Rab11-FIP5; Gamma-SNAP-associated Factor 1; GAF1; Gaf-1; KIAA0857; Phosphoprotein pp75; pp75; Rab11-interacting Protein Rip11; RIP11) (MaxLight 750); anti-RAB11FIP5 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3A8
Specificity
Recognizes human RAB11FIP5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-RAB11FIP5 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa554-652 from human RAB11FIP5 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SGLEKLKTVTSGSIQPVTQAPQAGQMVDTKRLKDSAVLDQSAKYYHLTHDELISLLLQRERELSQRDEHVQELESYIDRLLVRIMETSPTLLQIPPGPP
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Testing Data
(Detection limit for recombinant GST tagged RAB11FIP5 is 0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged RAB11FIP5 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-RAB11FIP5 antibody
MaxLight750 is a new Near IR stable dye conjugate comparable to DyLight750, Alexa Fluor700 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (759nm); Emission (780nm); Extinction Coefficient 240,000.
Product Categories/Family for anti-RAB11FIP5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Full Name
rab11 family-interacting protein 5
NCBI Official Synonym Full Names
RAB11 family interacting protein 5
NCBI Official Symbol
RAB11FIP5
NCBI Official Synonym Symbols
GAF1; pp75; RIP11
NCBI Protein Information
rab11 family-interacting protein 5
UniProt Protein Name
Rab11 family-interacting protein 5
Protein Family
UniProt Gene Name
RAB11FIP5
UniProt Synonym Gene Names
GAF1; KIAA0857; RIP11; Rab11-FIP5; Gaf-1
UniProt Entry Name
RFIP5_HUMAN
Uniprot Description
RAB11FIP5: Rab effector involved in protein trafficking from apical recycling endosomes to the apical plasma membrane.
Protein type: Cytoskeletal
Chromosomal Location of Human Ortholog: 2p13
Cellular Component: Golgi membrane; Golgi apparatus; mitochondrial outer membrane; recycling endosome; intracellular membrane-bound organelle; early endosome membrane; recycling endosome membrane; early endosome; microtubule organizing center; secretory granule
Molecular Function: protein binding; gamma-tubulin binding; Rab GTPase binding
Biological Process: regulated secretory pathway
Research Articles on RAB11FIP5
Similar Products
Product Notes
The RAB11FIP5 rab11fip5 (Catalog #AAA6234811) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAB11FIP5 (Rab11 Family-interacting Protein 5, Rab11-FIP5, Gamma-SNAP-associated Factor 1, GAF1, Gaf-1, KIAA0857, Phosphoprotein pp75, pp75, Rab11-interacting Protein Rip11, RIP11) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAB11FIP5 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAB11FIP5 rab11fip5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAB11FIP5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
