Mouse PYGM Monoclonal Antibody | anti-PYGM antibody

PYGM (Phosphorylase, glycogen, Muscle) (FITC)

Cat. Num. AAA6178115

• Applications: Western Blot
• Purity: Purified
• Synonyms: PYGM; Monoclonal Antibody; PYGM (Phosphorylase; glycogen; Muscle) (FITC); Phosphorylase; Muscle; anti-PYGM antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2C4
• Specificity: Recognizes PYGM.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-PYGM antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PYGM (NP_005600.1, 734aa-842aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DRIPELRQVIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEDYIKCQEKVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEAI
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PYGM monoclonal antibody (M10), clone 2C4. Western Blot analysis of PYGM expression in HepG2.)

Western Blot (WB)

(PYGM monoclonal antibody (M10), clone 2C4. Western Blot analysis of PYGM expression in NIH/3T3.)

Western Blot (WB)

(PYGM monoclonal antibody (M10), clone 2C4. Western Blot analysis of PYGM expression in PC-12.)

Western Blot (WB)

(PYGM monoclonal antibody (M10), clone 2C4. Western Blot analysis of PYGM expression in Raw 264.7.)

Testing Data

(Detection limit for recombinant GST tagged PYGM is 1 ng/ml as a capture antibody.)

Related Product Information for anti-PYGM antibody

This gene encodes a muscle enzyme involved in glycogenolysis. Highly similar enzymes encoded by different genes are found in liver and brain. Mutations in this gene are associated with McArdle disease (myophosphorylase deficiency), a glycogen storage disease of muscle. Alternative splicing results in multiple transcript variants.

Product Categories/Family for anti-PYGM antibody

Antibodies; Enzymes; Phosphorylase

NCBI and Uniprot Product Information

• NCBI GI #: 5032009
• NCBI GeneID: 5837
• NCBI Accession #: NP_005600.1
• NCBI GenBank Nucleotide #: NM_005609.2
• UniProt Accession #: P11217; A0AVK1; A6NDY6
• Molecular Weight: 97,092 Da
• NCBI Official Full Name: glycogen phosphorylase, muscle form isoform 1
• NCBI Official Synonym Full Names: phosphorylase, glycogen, muscle
• NCBI Official Symbol: PYGM
• NCBI Protein Information: glycogen phosphorylase, muscle form; myophosphorylase
• UniProt Protein Name: Glycogen phosphorylase, muscle form
• Protein Family: Glycogen phosphorylase
• UniProt Gene Name: PYGM
• UniProt Entry Name: PYGM_HUMAN

NCBI Description

This gene encodes a muscle enzyme involved in glycogenolysis. Highly similar enzymes encoded by different genes are found in liver and brain. Mutations in this gene are associated with McArdle disease (myophosphorylase deficiency), a glycogen storage disease of muscle. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Sep 2009]

Uniprot Description

PYGM: an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties. Dimers associate into a tetramer to form the enzymatically active phosphorylase A. Phosphorylation of Ser-14 converts phosphorylase B (unphosphorylated) to phosphorylase A.

Protein type: Phosphorylase; Carbohydrate Metabolism - starch and sucrose; Transferase; Endoplasmic reticulum; EC 2.4.1.1

Chromosomal Location of Human Ortholog: 11q12-q13.2

Cellular Component: cytosol

Molecular Function: glycogen phosphorylase activity; nucleotide binding; pyridoxal phosphate binding

Biological Process: glycogen metabolic process; glycogen catabolic process; carbohydrate metabolic process; glucose metabolic process; pathogenesis

Disease: Glycogen Storage Disease V