Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PURA monoclonal antibody (M07), clone 1D6. Western Blot analysis of PURA expression in human skeletal muscle.)

Mouse PURA Monoclonal Antibody | anti-PURA antibody

PURA (Purine-Rich Element Binding Protein A, PUR-ALPHA, PUR1, PURALPHA) (PE)

Gene Names
PURA; PUR1; MRD31; PURALPHA; PUR-ALPHA
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
PURA; Monoclonal Antibody; PURA (Purine-Rich Element Binding Protein A; PUR-ALPHA; PUR1; PURALPHA) (PE); Purine-Rich Element Binding Protein A; PURALPHA; anti-PURA antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1D6
Specificity
Recognizes PURA.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PURA antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PURA (NP_005850, 183aa-292aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TQGQTIALPAQGLIEFRDALAKLIDDYGVEEEPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEETKKIQEKQREKRAAC
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(PURA monoclonal antibody (M07), clone 1D6. Western Blot analysis of PURA expression in human skeletal muscle.)

Western Blot (WB) (PURA monoclonal antibody (M07), clone 1D6. Western Blot analysis of PURA expression in human skeletal muscle.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PURA on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PURA on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PURA on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PURA on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-PURA antibody
This gene product is a sequence-specific, single-stranded DNA-binding protein. It binds preferentially to the single strand of the purine-rich element termed PUR, which is present at origins of replication and in gene flanking regions in a variety of eukaryotes from yeasts through humans. Thus, it is implicated in the control of both DNA replication and transcription. Deletion of this gene has been associated with myelodysplastic syndrome and acute myelogenous leukemia. [provided by RefSeq]
Product Categories/Family for anti-PURA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,911 Da
NCBI Official Full Name
transcriptional activator protein Pur-alpha
NCBI Official Synonym Full Names
purine-rich element binding protein A
NCBI Official Symbol
PURA
NCBI Official Synonym Symbols
PUR1; MRD31; PURALPHA; PUR-ALPHA
NCBI Protein Information
transcriptional activator protein Pur-alpha; purine-rich single-stranded DNA-binding protein alpha
UniProt Protein Name
Transcriptional activator protein Pur-alpha
Protein Family
UniProt Gene Name
PURA
UniProt Synonym Gene Names
PUR1
UniProt Entry Name
PURA_HUMAN

Similar Products

Product Notes

The PURA pura (Catalog #AAA6185696) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PURA can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PURA pura for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PURA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.