Interleukin-1 receptor antagonist Recombinant Protein | IL-1ra recombinant protein

Recombinant Human Interleukin-1 receptor antagonist protein

Cat. Num. AAA1265327

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-1 receptor antagonist; Recombinant Human Interleukin-1 receptor antagonist protein; ICIL-1; RAIL1 inhibitor; INN: Anakinra; IL-1ra recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 26-177aa; Full Length
• Sequence: RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
• Sequence Length: 159

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for IL-1ra recombinant protein

Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling. Has no interleukin-1 like activity. Binds functional interleukin-1 receptor IL1R1 with greater affinity than decoy receptor IL1R2; however, the physiological relevance of the latter association is unsure.

Product Categories/Family for IL-1ra recombinant protein

Immunology

References

Purification, cloning, expression and biological characterization of an interleukin-1 receptor antagonist protein.Carter D.B., Deibel M.R. Jr., Dunn C.J., Tomich C.S.C., Laborde A.L., Slightom J.L., Berger A.E., Bienkowski M.J., Sun F.F., McEwan R.N., Harris P.K.W., Yem A.W., Waszak G.A., Chosay J.G., Sieu L.C., Hardee M.M., Zurcher-Neely H.A., Reardon I.M., Heinrikson R.L., Truesdell S.E., Shelly J.A., Eessalu T.E., Taylor B.M., Tracey D.E.Nature 344:633-638(1990) Primary structure and functional expression from complementary DNA of a human interleukin-1 receptor antagonist.Eisenberg S.P., Evans R.J., Arend W.P., Verderber E., Brewer M.T., Hannum C.H., Thompson R.C.Nature 343:341-346(1990) Interleukin 1 receptor antagonist is a member of the interleukin 1 gene family evolution of a cytokine control mechanism.Eisenberg S.P., Brewer M.T., Verderber E., Heimdal P., Brandhuber B.J., Thompson R.C.Proc. Natl. Acad. Sci. U.S.A. 88:5232-5236(1991) Cloning and chromosome mapping of the human interleukin-1 receptor antagonist gene.Lennard A., Gorman P., Carrier M., Griffiths S., Scotney H., Sheer D., Solari R.Cytokine 4:83-89(1992) Intracellular IL-1 receptor antagonist promoter cell type-specific and inducible regulatory regions.Jenkins J.K., Drong R.F., Shuck M.E., Bienkowski M.J., Slightom J.L., Arend W.P., Smith M.F. Jr.J. Immunol. 158:748-755(1997) cDNA cloning of an intracellular form of the human interleukin 1 receptor antagonist associated with epithelium.Haskill S., Martin G., van Le L., Morris J., Peace A., Bigler C.F., Jaffe G.J., Hammerberg C., Sporn S.A., Fong S., Arend W.P., Ralph P.Proc. Natl. Acad. Sci. U.S.A. 88:3681-3685(1991) Cloning and characterization of a new isoform of the interleukin 1 receptor antagonist.Muzio M., Polentarutti N., Sironi M., Poli G., De Gioia L., Introna M., Mantovani A., Colotta F.J. Exp. Med. 182:623-628(1995) SeattleSNPs variation discovery resourceComplete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005)

NCBI and Uniprot Product Information

• NCBI GI #: 10835147
• NCBI GeneID: 3557
• NCBI Accession #: NP_000568.1
• NCBI GenBank Nucleotide #: NM_000577.4
• UniProt Accession #: P18510; Q14628; Q53SC2; Q7RTZ4; Q96GD6; Q9UPC0; A8K4G1
• Molecular Weight: 21.1 kDa
• NCBI Official Full Name: interleukin-1 receptor antagonist protein isoform 3
• UniProt Protein Name: Interleukin-1 receptor antagonist protein
• Protein Family: Interleukin-1 receptor antagonist protein
• UniProt Gene Name: IL1RN
• UniProt Synonym Gene Names: IL1F3; IL1RA; IL-1RN; IL-1ra; IRAP
• UniProt Entry Name: IL1RA_HUMAN

Uniprot Description

IL1RN: Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling. Has no interleukin-1 like activity. Binds functional interleukin-1 receptor IL1R1 with greater affinity than decoy receptor IL1R2; however, the physiological relevance of the latter association is unsure. The intracellular form of IL1RN is predominantly expressed in epithelial cells. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Cytokine; Secreted; Vesicle

Chromosomal Location of Human Ortholog: 2q14.2

Cellular Component: cytoplasm; extracellular space; intracellular; plasma membrane

Molecular Function: cytokine activity; interleukin-1 receptor antagonist activity; interleukin-1 receptor binding; interleukin-1 Type I receptor antagonist activity; interleukin-1 Type II receptor antagonist activity; interleukin-1, Type I receptor binding; interleukin-1, Type II receptor binding; protein binding

Biological Process: acute-phase response; cytokine and chemokine mediated signaling pathway; fever; immune response; inflammatory response to antigenic stimulus; insulin secretion; lipid metabolic process; negative regulation of cytokine and chemokine mediated signaling pathway; negative regulation of heterotypic cell-cell adhesion; response to glucocorticoid stimulus

Disease: Gastric Cancer, Hereditary Diffuse; Microvascular Complications Of Diabetes, Susceptibility To, 4; Osteomyelitis, Sterile Multifocal, With Periostitis And Pustulosis