Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry analysis using 132088 on formalin-fixed paraffin-embedded human pancreas. [3ug/ml])

Mouse anti-Human PTRF Monoclonal Antibody | anti-PTRF antibody

PTRF (Polymerase I and Transcript Release Factor, CAVIN1, Cavin-1, CAVIN, CGL4, FKSG13) (FITC)

Gene Names
PTRF; CGL4; CAVIN; CAVIN1; FKSG13; cavin-1
Reactivity
Human
Applications
Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PTRF; Monoclonal Antibody; PTRF (Polymerase I and Transcript Release Factor; CAVIN1; Cavin-1; CAVIN; CGL4; FKSG13) (FITC); anti-PTRF antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1F7
Specificity
Recognizes human PTRF.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PTRF antibody
FLISA, Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: detects PTRF using immunoperoxidase staining on formalin fixed, paraffin embedded human pancreas.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa233-321 from human PTRF with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPAERREKLKTSRDKLRKSFTPDHVVYARSKTAVYKVPPF*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunohistochemistry (IHC)

(Immunohistochemistry analysis using 132088 on formalin-fixed paraffin-embedded human pancreas. [3ug/ml])

Immunohistochemistry (IHC) (Immunohistochemistry analysis using 132088 on formalin-fixed paraffin-embedded human pancreas. [3ug/ml])
Product Categories/Family for anti-PTRF antibody
References
1. SDPR induces membrane curvature and functions in the formation of caveolae. Hansen CG, Bright NA, Howard G, Nichols BJ.Nat Cell Biol. 2009 Jul;11(7):807-14. Epub 2009 Jun 14.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43 kDa
NCBI Official Full Name
polymerase I and transcript release factor
NCBI Official Synonym Full Names
polymerase I and transcript release factor
NCBI Official Symbol
PTRF
NCBI Official Synonym Symbols
CGL4; CAVIN; CAVIN1; FKSG13; cavin-1
NCBI Protein Information
polymerase I and transcript release factor; PTRF; TTF-I interacting peptide 12; RNA polymerase I and transcript release factor
UniProt Protein Name
Polymerase I and transcript release factor
UniProt Gene Name
PTRF
UniProt Entry Name
PTRF_HUMAN

NCBI Description

This gene encodes a protein that enables the dissociation of paused ternary polymerase I transcription complexes from the 3' end of pre-rRNA transcripts. This protein regulates rRNA transcription by promoting the dissociation of transcription complexes and the reinitiation of polymerase I on nascent rRNA transcripts. This protein also localizes to caveolae at the plasma membrane and is thought to play a critical role in the formation of caveolae and the stabilization of caveolins. This protein translocates from caveolae to the cytoplasm after insulin stimulation. Caveolae contain truncated forms of this protein and may be the site of phosphorylation-dependent proteolysis. This protein is also thought to modify lipid metabolism and insulin-regulated gene expression. Mutations in this gene result in a disorder characterized by generalized lipodystrophy and muscular dystrophy. [provided by RefSeq, Nov 2009]

Uniprot Description

PTRF: Plays an important role in caveolae formation and organization. Required for the sequestration of mobile caveolin into immobile caveolae. Termination of transcription by RNA polymerase I involves pausing of transcription by TTF1, and the dissociation of the transcription complex, releasing pre-rRNA and RNA polymerase I from the template. PTRF is required for dissociation of the ternary transcription complex. Defects in PTRF are the cause of congenital generalized lipodystrophy type 4 (CGL4). It is a disorder characterized by the association of congenital generalized lipodystrophy with muscular dystrophy and cardiac anomalies. Congenital generalized lipodystrophy is characterized by a near complete absence of adipose tissue, extreme insulin resistance, hypertriglyceridemia, hepatic steatosis and early onset of diabetes. Belongs to the PTRF/SDPR family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription initiation complex

Chromosomal Location of Human Ortholog: 17q21.2

Cellular Component: nucleoplasm; protein complex; mitochondrion; intracellular membrane-bound organelle; endoplasmic reticulum; cytoplasm; plasma membrane; caveola; cytosol; nucleus

Molecular Function: protein binding; rRNA primary transcript binding

Biological Process: regulation of transcription, DNA-dependent; transcription from RNA polymerase I promoter; gene expression; termination of RNA polymerase I transcription; transcription initiation from RNA polymerase I promoter

Disease: Lipodystrophy, Congenital Generalized, Type 4

Research Articles on PTRF

Similar Products

Product Notes

The PTRF ptrf (Catalog #AAA6149136) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PTRF (Polymerase I and Transcript Release Factor, CAVIN1, Cavin-1, CAVIN, CGL4, FKSG13) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTRF can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin. IHC-P: detects PTRF using immunoperoxidase staining on formalin fixed, paraffin embedded human pancreas. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PTRF ptrf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PTRF, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.