Mouse anti-Human PTRF Monoclonal Antibody | anti-PTRF antibody

PTRF (Polymerase I and Transcript Release Factor, CAVIN1, Cavin-1, CAVIN, CGL4, FKSG13) (HRP)

Cat. Num. AAA6154439

• Gene Names: PTRF; CGL4; CAVIN; CAVIN1; FKSG13; cavin-1
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PTRF; Monoclonal Antibody; PTRF (Polymerase I and Transcript Release Factor; CAVIN1; Cavin-1; CAVIN; CGL4; FKSG13) (HRP); anti-PTRF antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1F7
• Specificity: Recognizes human PTRF.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-PTRF antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin
• Application Notes: IHC-P: detects PTRF using immunoperoxidase staining on formalin fixed, paraffin embedded human pancreas.; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa233-321 from human PTRF with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPAERREKLKTSRDKLRKSFTPDHVVYARSKTAVYKVPPF*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunohistochemistry (IHC)

(Immunohistochemistry analysis using 132088 on formalin-fixed paraffin-embedded human pancreas. [3ug/ml])

Product Categories/Family for anti-PTRF antibody

Antibodies; Transcription Factors

References

1. SDPR induces membrane curvature and functions in the formation of caveolae. Hansen CG, Bright NA, Howard G, Nichols BJ.Nat Cell Biol. 2009 Jul;11(7):807-14. Epub 2009 Jun 14.

NCBI and Uniprot Product Information

• NCBI GI #: 42734430
• NCBI GeneID: 284119
• NCBI Accession #: NP_036364
• NCBI GenBank Nucleotide #: NM_012232
• UniProt Accession #: Q6NZI2; O00535; Q6GMY1; Q96H74; Q9BT85; Q9HAP4; B2RAW7
• Molecular Weight: 43 kDa
• NCBI Official Full Name: polymerase I and transcript release factor
• NCBI Official Synonym Full Names: polymerase I and transcript release factor
• NCBI Official Symbol: PTRF
• NCBI Official Synonym Symbols: CGL4; CAVIN; CAVIN1; FKSG13; cavin-1
• NCBI Protein Information: polymerase I and transcript release factor; PTRF; TTF-I interacting peptide 12; RNA polymerase I and transcript release factor
• UniProt Protein Name: Polymerase I and transcript release factor
• Protein Family: Polymerase I and transcript release factor
• UniProt Gene Name: PTRF
• UniProt Entry Name: PTRF_HUMAN

NCBI Description

This gene encodes a protein that enables the dissociation of paused ternary polymerase I transcription complexes from the 3' end of pre-rRNA transcripts. This protein regulates rRNA transcription by promoting the dissociation of transcription complexes and the reinitiation of polymerase I on nascent rRNA transcripts. This protein also localizes to caveolae at the plasma membrane and is thought to play a critical role in the formation of caveolae and the stabilization of caveolins. This protein translocates from caveolae to the cytoplasm after insulin stimulation. Caveolae contain truncated forms of this protein and may be the site of phosphorylation-dependent proteolysis. This protein is also thought to modify lipid metabolism and insulin-regulated gene expression. Mutations in this gene result in a disorder characterized by generalized lipodystrophy and muscular dystrophy. [provided by RefSeq, Nov 2009]

Uniprot Description

PTRF: Plays an important role in caveolae formation and organization. Required for the sequestration of mobile caveolin into immobile caveolae. Termination of transcription by RNA polymerase I involves pausing of transcription by TTF1, and the dissociation of the transcription complex, releasing pre-rRNA and RNA polymerase I from the template. PTRF is required for dissociation of the ternary transcription complex. Defects in PTRF are the cause of congenital generalized lipodystrophy type 4 (CGL4). It is a disorder characterized by the association of congenital generalized lipodystrophy with muscular dystrophy and cardiac anomalies. Congenital generalized lipodystrophy is characterized by a near complete absence of adipose tissue, extreme insulin resistance, hypertriglyceridemia, hepatic steatosis and early onset of diabetes. Belongs to the PTRF/SDPR family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription initiation complex

Chromosomal Location of Human Ortholog: 17q21.2

Cellular Component: nucleoplasm; protein complex; mitochondrion; intracellular membrane-bound organelle; endoplasmic reticulum; cytoplasm; plasma membrane; caveola; cytosol; nucleus

Molecular Function: protein binding; rRNA primary transcript binding

Biological Process: regulation of transcription, DNA-dependent; transcription from RNA polymerase I promoter; gene expression; termination of RNA polymerase I transcription; transcription initiation from RNA polymerase I promoter

Disease: Lipodystrophy, Congenital Generalized, Type 4