Mouse anti-Human PTPN4 Monoclonal Antibody | anti-PTPN4 antibody

PTPN4 (Tyrosine-protein Phosphatase Non-receptor Type 4, Protein-tyrosine Phosphatase MEG1, PTPase-MEG1, MEG) APC

Cat. Num. AAA6138524

• Gene Names: PTPN4; MEG; PTPMEG; PTPMEG1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PTPN4; Monoclonal Antibody; PTPN4 (Tyrosine-protein Phosphatase Non-receptor Type 4; Protein-tyrosine Phosphatase MEG1; PTPase-MEG1; MEG) APC; anti-PTPN4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG3,k
• Clone Number: 3C8
• Specificity: Recognizes human PTPN4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-PTPN4 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa361-461, from human PTPN4 (NP_002821) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KPLARKLMDWEVVSRNSISDDRLETQSLPSRSPPGTPNHRNSTFTQEGTRLRPSSVGHLVDHMVHTSPSEVFVNQRSPSSTQANSIVLESSPSQETPGDG
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PTPN4 is ~3ng/ml as a capture antibody.)

Related Product Information for anti-PTPN4 antibody

MEG1 is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This protein contains a C-terminal PTP domain and an N-terminal domain homologous to the band 4.1 superfamily of cytoskeletal-associated proteins. This PTP has been shown to interact with glutamate receptor delta 2 and epsilon subunits, and is thought to play a role in signalling downstream of the glutamate receptors through tyrosine dephosphorylation.

Product Categories/Family for anti-PTPN4 antibody

Antibodies; Enzymes; Phosphatase

NCBI and Uniprot Product Information

• NCBI GI #: 4506295
• NCBI GeneID: 5775
• NCBI Accession #: NP_002821
• NCBI GenBank Nucleotide #: NM_002830
• UniProt Accession #: P29074; Q9UDA7; B2RBV8
• Molecular Weight: 32kDa (280aa)
• NCBI Official Full Name: tyrosine-protein phosphatase non-receptor type 4
• NCBI Official Synonym Full Names: protein tyrosine phosphatase, non-receptor type 4
• NCBI Official Symbol: PTPN4
• NCBI Official Synonym Symbols: MEG; PTPMEG; PTPMEG1
• NCBI Protein Information: tyrosine-protein phosphatase non-receptor type 4
• UniProt Protein Name: Tyrosine-protein phosphatase non-receptor type 4
• Protein Family: Tyrosine-protein phosphatase non-receptor
• UniProt Gene Name: PTPN4
• UniProt Synonym Gene Names: MEG; PTPase-MEG1
• UniProt Entry Name: PTN4_HUMAN

NCBI Description

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This protein contains a C-terminal PTP domain and an N-terminal domain homologous to the band 4.1 superfamily of cytoskeletal-associated proteins. This PTP has been shown to interact with glutamate receptor delta 2 and epsilon subunits, and is thought to play a role in signalling downstream of the glutamate receptors through tyrosine dephosphorylation. [provided by RefSeq, Jul 2008]

Uniprot Description

PTPN4: May act at junctions between the membrane and the cytoskeleton. Belongs to the protein-tyrosine phosphatase family. Non-receptor class subfamily.

Protein type: EC 3.1.3.48; Motility/polarity/chemotaxis; Protein phosphatase, tyrosine (non-receptor)

Chromosomal Location of Human Ortholog: 2q14.2

Cellular Component: cytoplasm; internal side of plasma membrane

Molecular Function: protein binding

Biological Process: protein amino acid dephosphorylation