Mouse anti-Human PTPN22 Monoclonal Antibody | anti-PTPN22 antibody

PTPN22 (Tyrosine-protein Phosphatase Non-receptor Type 22, Hematopoietic Cell Protein-tyrosine Phosphatase 70Z-PEP, Lymphoid Phosphatase, LyP, PEST-domain Phosphatase, PEP, PTPN8) (PE)

Cat. Num. AAA6159735

• Gene Names: PTPN22; LYP; PEP; LYP1; LYP2; PTPN8; PTPN22.5; PTPN22.6
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PTPN22; Monoclonal Antibody; PTPN22 (Tyrosine-protein Phosphatase Non-receptor Type 22; Hematopoietic Cell Protein-tyrosine Phosphatase 70Z-PEP; Lymphoid Phosphatase; LyP; PEST-domain Phosphatase; PEP; PTPN8) (PE); EC=3.1.3.48; LYP1; LYP2; anti-PTPN22 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4F6
• Specificity: Recognizes human PTPN22.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 1817

• Applicable Applications for anti-PTPN22 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: ELISA: 1ng/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-180 from human PTPN22 (AAH17785) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKEAEKRKSDYIIRTLKVKFNSVSVILAHQTSLQNLFSQITPAHF*
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (45.8kD).)

Western Blot (WB)

(Western Blot analysis of PTPN22 expression in transfected 293T cell line by PTPN22 monoclonal antibody. Lane 1: PTPN22 transfected lysate (85.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PTPN22 is 1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of PTPN22 over-expressed 293 cell line, cotransfected with PTPN22 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PTPN22 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-PTPN22 antibody

Antibodies; Enzymes; Phosphatase

NCBI and Uniprot Product Information

• NCBI GI #: 17389491
• NCBI GeneID: 26191
• NCBI Official Full Name: Homo sapiens protein tyrosine phosphatase, non-receptor type 22 (lymphoid), mRNA
• NCBI Official Synonym Full Names: protein tyrosine phosphatase non-receptor type 22
• NCBI Official Symbol: PTPN22
• NCBI Official Synonym Symbols: LYP; PEP; LYP1; LYP2; PTPN8; PTPN22.5; PTPN22.6
• NCBI Protein Information: tyrosine-protein phosphatase non-receptor type 22
• Protein Family: Tyrosine-protein phosphatase non-receptor

NCBI Description

This gene encodes of member of the non-receptor class 4 subfamily of the protein-tyrosine phosphatase family. The encoded protein is a lymphoid-specific intracellular phosphatase that associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway. Mutations in this gene may be associated with a range of autoimmune disorders including Type 1 Diabetes, rheumatoid arthritis, systemic lupus erythematosus and Graves' disease. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Mar 2009]