Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PTH expression in transfected 293T cell line by PTH monoclonal antibody (M14), clone 3E7.Lane 1: PTH transfected lysate(12.9 KDa).Lane 2: Non-transfected lysate.)

Mouse PTH Monoclonal Antibody | anti-PTH antibody

PTH (Parathyroid Hormone, PTH1) (APC)

Gene Names
PTH; PTH1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
PTH; Monoclonal Antibody; PTH (Parathyroid Hormone; PTH1) (APC); Parathyroid Hormone; PTH1; anti-PTH antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
30000000
Specificity
Recognizes PTH.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PTH antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PTH (NP_000306, 32aa-115aa) full-length recombinant protein.
Immunogen Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PTH expression in transfected 293T cell line by PTH monoclonal antibody (M14), clone 3E7.Lane 1: PTH transfected lysate(12.9 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PTH expression in transfected 293T cell line by PTH monoclonal antibody (M14), clone 3E7.Lane 1: PTH transfected lysate(12.9 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-PTH antibody
The protein encoded by this gene is a hormone secreted by parathyroid cells. This hormone elevates blood Ca2+ level by dissolving the salts in bone and preventing their renal excretion. Defects in this gene are a cause of familial isolated hypoparathyroidism (FIH). [provided by RefSeq]
Product Categories/Family for anti-PTH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9.55 kDa (85 aa), confirmed by MALDI-TOF.
NCBI Official Full Name
parathyroid hormone isoform 1 preproprotein
NCBI Official Synonym Full Names
parathyroid hormone
NCBI Official Symbol
PTH
NCBI Official Synonym Symbols
PTH1
NCBI Protein Information
parathyroid hormone
UniProt Protein Name
Parathyroid hormone
Protein Family
UniProt Gene Name
PTH
UniProt Synonym Gene Names
PTH
UniProt Entry Name
PTHY_HUMAN

NCBI Description

This gene encodes a member of the parathyroid family of proteins. The encoded preproprotein is proteolytically processed to generate a protein that binds to the parathyroid hormone/parathyroid hormone-related peptide receptor and regulates blood calcium and phosphate levels. Excess production of the encoded protein, known as hyperparathyroidism, can result in hypercalcemia and kidney stones. On the other hand, defective processing of the encoded protein may lead to hypoparathyroidism, which can result in hypocalcemia and numbness. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]

Uniprot Description

PTH: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2- deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells. Defects in PTH are a cause of familial isolated hypoparathyroidism (FIH); also called autosomal dominant hypoparathyroidism or autosomal dominant hypocalcemia. FIH is characterized by hypocalcemia and hyperphosphatemia due to inadequate secretion of parathyroid hormone. Symptoms are seizures, tetany and cramps. FIH exist both as autosomal dominant and recessive forms of hypoparathyroidism. Belongs to the parathyroid hormone family.

Protein type: Hormone; Secreted, signal peptide; Apoptosis; Secreted

Chromosomal Location of Human Ortholog: 11p15.3-p15.1

Cellular Component: extracellular space; extracellular region

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; type 1 parathyroid hormone receptor binding; parathyroid hormone receptor binding; peptide hormone receptor binding; hormone activity

Biological Process: response to drug; transcription from RNA polymerase II promoter; positive regulation of signal transduction; induction of apoptosis by hormones; positive regulation of glycogen biosynthetic process; negative regulation of transcription from RNA polymerase II promoter; positive regulation of bone mineralization; G-protein signaling, adenylate cyclase activating pathway; Rho protein signal transduction; cellular calcium ion homeostasis; G-protein coupled receptor protein signaling pathway; positive regulation of glucose import; response to cadmium ion; response to vitamin D; response to ethanol; cAMP metabolic process; cell-cell signaling; regulation of gene expression; response to lead ion; positive regulation of cAMP biosynthetic process; positive regulation of transcription from RNA polymerase II promoter; skeletal development; bone resorption

Disease: Hypoparathyroidism, Familial Isolated

Research Articles on PTH

Similar Products

Product Notes

The PTH pth (Catalog #AAA6166894) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PTH can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PTH pth for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PTH, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.